Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.39
PubTator Score 8.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
spina bifida -2.015 0.043

Synonym

Accession Q9NXV6 Q8TBM5 Q9NYH0
Symbols CARF

Gene

Gene RIF (10)

PMID Text
26531822 The results suggest that CARF regulates early steps of pre-rRNA processing during ribosome biogenesis by controlling spatial distribution of XRN2 between the nucleoplasm and nucleolus.
26278998 CARF promotes carcinogenesis in p53-deficient cells by repressing p21WAF1 and promoting cell cycle progression.
24825908 CARF regulates proliferative fate of human cells by dose-dependent regulation of DNA damage signaling.
22552337 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.
21052095 CARF knockdown elicited DNA damage response as evidenced by increased levels of phosphorylated ATM and gammaH2AX, leading to induction of mitotic arrest and eventual apoptosis.
19001376 CARF plays a dual role in regulating p53-mediated senescence and apoptosis, the two major tumor suppressor mechanisms.
18555516 CARF may act as a novel key regulator of the p53 pathway at multiple checkpoints
18292944 CARF exerts a vital control on the p53-HDM2-p21WAF1 pathway that is frequently altered in cancer cells.
17460193 CARF may exert a vital control on p53-HDM2-p21(WAF1) pathway that is central to the cell cycle control, senescence, and DNA damage response of human cells
12154087 cooperates with human p14ARF in activating p53

AA Sequence

MAQEVSEYLSQNPRVAAWVEALRCDGETDKHWRHRRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNR      1 - 70
QLQQLISFSMAWANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEP     71 - 140
SKKRVIEGKNSSAVEQDHAKTSAKTERASAQQENSSTCIGSAIKSESGNSARSSGISSQNSSTSDGDRSV    141 - 210
SSQSSSSVSSQVTTAGSGKASEAEAPDKHGSASFVSLLKSSVNSHMTQSTDSRQQSGSPKKSALEGSSAS    211 - 280
ASQSSSEIEVPLLGSSGSSEVELPLLSSKPSSETASSGLTSKTSSEASVSSSVAKNSSSSGTSLLTPKSS    281 - 350
SSTNTSLLTSKSTSQVAASLLASKSSSQTSGSLVSKSTSLASVSQLASKSSSQTSTSQLPSKSTSQSSES    351 - 420
SVKFSCKLTNEDVKQKQPFFNRLYKTVAWKLVAVGGFSPNVNHGELLNAAIEALKATLDVFFVPLKELAD    421 - 490
LPQNKSSQESIVCELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKVVVKICKRKYRGSEIEDLVLL    491 - 560
DEESRPVNLPPALKHPQELL                                                      561 - 580
//

Text Mined References (27)

PMID Year Title
26531822 2015 Collaborator of alternative reading frame protein (CARF) regulates early processing of pre-ribosomal RNA by retaining XRN2 (5'-3' exoribonuclease) in the nucleoplasm.
26278998 2015 CARF (Collaborator of ARF) overexpression in p53-deficient cells promotes carcinogenesis.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24825908 2014 Collaborator of ARF (CARF) regulates proliferative fate of human cells by dose-dependent regulation of DNA damage signaling.
24485912 2014 Molecular characterization of collaborator of ARF (CARF) as a DNA damage response and cell cycle checkpoint regulatory protein.
24462208 2014 PAXT-1 promotes XRN2 activity by stabilizing it through a conserved domain.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22552337 2012 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.
More...