Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.49
PubTator Score 8.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
spina bifida 1074 4.3e-02
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
spina bifida -2.015 4.3e-02

Gene RIF (10)

AA Sequence

MAQEVSEYLSQNPRVAAWVEALRCDGETDKHWRHRRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNR      1 - 70
QLQQLISFSMAWANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEP     71 - 140
SKKRVIEGKNSSAVEQDHAKTSAKTERASAQQENSSTCIGSAIKSESGNSARSSGISSQNSSTSDGDRSV    141 - 210
SSQSSSSVSSQVTTAGSGKASEAEAPDKHGSASFVSLLKSSVNSHMTQSTDSRQQSGSPKKSALEGSSAS    211 - 280
ASQSSSEIEVPLLGSSGSSEVELPLLSSKPSSETASSGLTSKTSSEASVSSSVAKNSSSSGTSLLTPKSS    281 - 350
SSTNTSLLTSKSTSQVAASLLASKSSSQTSGSLVSKSTSLASVSQLASKSSSQTSTSQLPSKSTSQSSES    351 - 420
SVKFSCKLTNEDVKQKQPFFNRLYKTVAWKLVAVGGFSPNVNHGELLNAAIEALKATLDVFFVPLKELAD    421 - 490
LPQNKSSQESIVCELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKVVVKICKRKYRGSEIEDLVLL    491 - 560
DEESRPVNLPPALKHPQELL                                                      561 - 580
//

Text Mined References (27)

PMID Year Title