Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.9e-08
pituitary cancer 1972 2.0e-05
acute myeloid leukemia 783 5.1e-03
sarcoidosis 370 1.2e-02
medulloblastoma, large-cell 6241 1.3e-02
Breast cancer 3578 2.9e-02
spina bifida 1074 3.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia 1.700 5.1e-03
Breast cancer 2.800 2.9e-02
medulloblastoma, large-cell -1.100 1.3e-02
ovarian cancer -1.500 3.9e-08
pituitary cancer -1.500 2.0e-05
sarcoidosis 1.700 1.2e-02
spina bifida -1.250 3.4e-02

Synonym

Accession Q9NXS3 Q0VAL5
Symbols BTBD5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MDHTSPTYMLANLTHLHSEQLLQGLNLLRQHHELCDIILRVGDVKIHAHKVVLASVSPYFKAMFTGNLSE      1 - 70
KENSEVEFQCIDETALQAIVEYAYTGTVFISQDTVESLLPAANLLQIKLVLKECCAFLESQLDPGNCIGI     71 - 140
SRFAETYGCRDLYLAATKYICQNFEAVCQTEEFFELTHADLDEIVSNDCLNVATEETVFYALESWIKYDV    141 - 210
QERQKYLAQLLNSVRLPLLSVKFLTRLYEANHLIRDDRTCKHLLNEALKYHFMPEHRLSHQTVLMTRPRC    211 - 280
APKVLCAVGGKSGLFACLDSVEMYFPQNDSWIGLAPLNIPRYEFGICVLDQKVYVIGGIATNVRPGVTIR    281 - 350
KHENSVECWNPDTNTWTSLERMNESRSTLGVVVLAGELYALGGYDGQSYLQSVEKYIPKIRKWQPVAPMT    351 - 420
TTRSCFAAAVLDGMIYAIGGYGPAHMNSVERYDPSKDSWEMVASMADKRIHFGVGVMLGFIFVVGGHNGV    421 - 490
SHLSSIERYDPHQNQWTVCRPMKEPRTGVGAAVIDNYLYVVGGHSGSSYLNTVQKYDPISDTWLDSAGMI    491 - 560
YCRCNFGLTAL                                                               561 - 571
//

Text Mined References (6)

PMID Year Title