Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
juvenile dermatomyositis 1189 2.36822166247735E-15
osteosarcoma 7933 1.75666406348876E-7
acute quadriplegic myopathy 1157 3.74392662849455E-7
Pick disease 1893 8.46927412396922E-7
ovarian cancer 8492 1.15701960687681E-6
pilocytic astrocytoma 3086 2.53439346682358E-4
sonic hedgehog group medulloblastoma 1482 4.29880442941292E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.93280470061678E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00170949703278157
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00250018635356169
pancreatic cancer 2300 0.00301053331574671
progressive supranuclear palsy 674 0.00367222568265501
astrocytic glioma 2241 0.0142511134512667
oligodendroglioma 2849 0.0158342720349199
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0164251077772134
ependymoma 2514 0.0225734830404677
glioblastoma 5572 0.0333324311448252
lung cancer 4473 0.0357513384652286

Expression

Synonym

Accession Q9NXR5 Q5VW12 Q9BV12
Symbols

Gene

  Ortholog (14)

AA Sequence

MSAAGAGAGVEAGFSSEELLSLRFPLHRACRDGDLATLCSLLQQTPHAHLASEDSFYGWTPVHWAAHFGK      1 - 70
LECLVQLVRAGATLNVSTTRYAQTPAHIAAFGGHPQCLVWLIQAGANINKPDCEGETPIHKAARSGSLEC     71 - 140
ISALVANGAHVDLRNASGLTAADIAQTQGFQECAQFLLNLQNCHLNHFYNNGILNGGHQNVFPNHISVGT    141 - 210
NRKRCLEDSEDFGVKKARTEAQSLDSAVPLTNGDTEDDADKMHVDREFAVVTDMKNSSSVSNTLTNGCVI    211 - 280
NGHLDFPSTTPLSGMESRNGQCLTGTNGISSGLAPGQPFPSSQGSLCISGTEEPEKTLRANPELCGSLHL    281 - 350
NGSPSSCIASRPSWVEDIGDNLYYGHYHGFGDTAESIPELNSVVEHSKSVKVQERYDSAVLGTMHLHHGS    351 - 420
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.