Property Summary

NCBI Gene PubMed Count 5
Grant Count 1
R01 Count 1
Funding $600,150
PubMed Score 7.69
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.700 0.003
colon cancer -1.700 0.000
ovarian cancer 1.100 0.000

Gene RIF (2)

PMID Text
18854154 Knockdown of protein phosphatase 1, regulatory subunit 14D (PPP1R14D) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
12974676 A gastrointestinal- and brain-specific PP1 inhibitory protein (GBPI-1)is activated by PKC phosphorylation. A longer GBPI-2 splice variant mRNA is found in testes.

AA Sequence

MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWL      1 - 70
EMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRL     71 - 140
SRPQK                                                                     141 - 145
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12974676 2004 GBPI, a novel gastrointestinal- and brain-specific PP1-inhibitory protein, is activated by PKC and inactivated by PKA.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11948623 2002 Regulator-driven functional diversification of protein phosphatase-1 in eukaryotic evolution.