Property Summary

NCBI Gene PubMed Count 11
Grant Count 12
R01 Count 1
Funding $1,205,869.26
PubMed Score 423.72
PubTator Score 588.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.600 0.000
atypical teratoid / rhabdoid tumor -1.200 0.007
medulloblastoma, large-cell -1.400 0.001
primitive neuroectodermal tumor -1.400 0.030
sonic hedgehog group medulloblastoma -1.100 0.000
subependymal giant cell astrocytoma -1.049 0.019
lung carcinoma 1.400 0.000
Pick disease -1.500 0.000
ovarian cancer 1.500 0.000

Gene RIF (7)

PMID Text
24895555 This review will expand our knowledge of biology of HIFs, PHDs, PHD inhibitors, and bone regeneration, and it may also aid the design of novel therapies for accelerating bone repair and regeneration or inhibiting bone tumours. [review]
23284715 The yeast two-hybrid screen and the coimmunoprecipitation analysis identify the HIV-1 Nef interacting human protein prolyl 4-hydroxylase (PH4) in cells
23241241 Results suggest that increased expression of prolyl hydroxylase (PH) might play an role in the physiology of uterine leiomyoma during the menstrual cycle.
16154531 This review summarizes recent progress in elucidating the molecular mechanisms of hypoxia-inducible factor (HIF)-1 activation, focusing on the role of oxygen-dependent asparaginyl hydroxylase in hypoxia signal transduction.
15456751 crystal structure of the peptide-substrate-binding domain
12788921 the longest and shortest isoenzymes have major transcripts encoding inactive polypeptides, which suggest novel regulation by alternative splicing.
12163023 Data suggest that PH-4 is a novel hypoxia-inducible factor-prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia.

AA Sequence

MAAAAVTGQRPETAAAEEASRPQWAPPDHCQAQAAAGLGDGEDAPVRPLCKPRGICSRAYFLVLMVFVHL      1 - 70
YLGNVLALLLFVHYSNGDESSDPGPQHRAQGPGPEPTLGPLTRLEGIKVGHERKVQLVTDRDHFIRTLSL     71 - 140
KPLLFEIPGFLTDEECRLIIHLAQMKGLQRSQILPTEEYEEAMSTMQVSQLDLFRLLDQNRDGHLQLREV    141 - 210
LAQTRLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWL    211 - 280
YQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANES    281 - 350
VPFETSCRYMTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQGTAVF    351 - 420
WYNYLPDGQGWVGDVDDYSLHGGCLVTRGTKWIANNWINVDPSRARQALFQQEMARLAREGGTDSQPEWA    421 - 490
LDRAYRDARVEL                                                              491 - 502
//

Text Mined References (12)

PMID Year Title
24895555 2014 The hypoxia-inducible factor pathway, prolyl hydroxylase domain protein inhibitors, and their roles in bone repair and regeneration.
23241241 2012 Human prolyl hydroxylase expression in uterine leiomyoma during the menstrual cycle.
22955912 2012 Transmembrane prolyl 4-hydroxylase is a fourth prolyl 4-hydroxylase regulating EPO production and erythropoiesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17726031 2007 An endoplasmic reticulum transmembrane prolyl 4-hydroxylase is induced by hypoxia and acts on hypoxia-inducible factor alpha.
16154531 2005 Regulation of hypoxia-inducible factor 1 by prolyl and asparaginyl hydroxylases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456751 2004 The peptide-substrate-binding domain of collagen prolyl 4-hydroxylases is a tetratricopeptide repeat domain with functional aromatic residues.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12788921 2003 Characterization of the human prolyl 4-hydroxylases that modify the hypoxia-inducible factor.
More...