Property Summary

Ligand Count 21
NCBI Gene PubMed Count 12
PubMed Score 473.77
PubTator Score 588.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 6.5e-03
lung carcinoma 1.400 5.9e-24
medulloblastoma, large-cell -1.400 8.5e-04
ovarian cancer 1.500 3.3e-05
Pick disease -1.500 2.2e-04
primitive neuroectodermal tumor -1.400 3.0e-02
psoriasis 1.600 1.9e-04
sonic hedgehog group medulloblastoma -1.100 1.8e-04
subependymal giant cell astrocytoma -1.049 1.9e-02

Gene RIF (8)

AA Sequence

MAAAAVTGQRPETAAAEEASRPQWAPPDHCQAQAAAGLGDGEDAPVRPLCKPRGICSRAYFLVLMVFVHL      1 - 70
YLGNVLALLLFVHYSNGDESSDPGPQHRAQGPGPEPTLGPLTRLEGIKVGHERKVQLVTDRDHFIRTLSL     71 - 140
KPLLFEIPGFLTDEECRLIIHLAQMKGLQRSQILPTEEYEEAMSTMQVSQLDLFRLLDQNRDGHLQLREV    141 - 210
LAQTRLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWL    211 - 280
YQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANES    281 - 350
VPFETSCRYMTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQGTAVF    351 - 420
WYNYLPDGQGWVGDVDDYSLHGGCLVTRGTKWIANNWINVDPSRARQALFQQEMARLAREGGTDSQPEWA    421 - 490
LDRAYRDARVEL                                                              491 - 502
//

Text Mined References (13)

PMID Year Title