Property Summary

NCBI Gene PubMed Count 7
Grant Count 158
R01 Count 65
Funding $42,563,015.44
PubMed Score 566.46
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.100 0.004
ovarian cancer -1.500 0.000

Synonym

Accession Q9NXG2 Q9BWC3
Symbols Tan1

Gene

PDB

2DIR  

Gene RIF (1)

PMID Text
22190034 HIV-1 NC is identified to have a physical interaction with THUMP domain containing 1 (THUMPD1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MAAPAQQTTQPGGGKRKGKAQYVLAKRARRCDAGGPRQLEPGLQGILITCNMNERKCVEEAYSLLNEYGD      1 - 70
DMYGPEKFTDKDQQPSGSEGEDDDAEAALKKEVGDIKASTEMRLRRFQSVESGANNVVFIRTLGIEPEKL     71 - 140
VHHILQDMYKTKKKKTRVILRMLPISGTCKAFLEDMKKYAETFLEPWFKAPNKGTFQIVYKSRNNSHVNR    141 - 210
EEVIRELAGIVCTLNSENKVDLTNPQYTVVVEIIKAVCCLSVVKDYMLFRKYNLQEVVKSPKDPSQLNSK    211 - 280
QGNGKEAKLESADKSDQNNTAEGKNNQQVPENTEELGQTKPTSNPQVVNEGGAKPELASQATEGSKSNEN    281 - 350
DFS                                                                       351 - 353
//

Publication (17)

PMID Year Title
25653167 2015 Yeast Kre33 and human NAT10 are conserved 18S rRNA cytosine acetyltransferases that modify tRNAs assisted by the adaptor Tan1/THUMPD1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
More...