Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.86
PubTator Score 0.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -2.800 0.000
astrocytic glioma -2.200 0.003
ependymoma -2.300 0.002
oligodendroglioma -2.100 0.005
psoriasis 1.100 0.000
glioblastoma -3.000 0.000
osteosarcoma -1.946 0.001
medulloblastoma -2.600 0.000
cystic fibrosis 1.177 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -1.700 0.000
non-small cell lung cancer -1.052 0.000
lung cancer -1.500 0.002
breast carcinoma -1.500 0.001
pediatric high grade glioma -2.500 0.000
pilocytic astrocytoma -1.800 0.000
subependymal giant cell astrocytoma -2.281 0.027
lung adenocarcinoma -2.600 0.000
pulmonary arterial hypertension -2.200 0.043
ductal carcinoma in situ -1.100 0.012
invasive ductal carcinoma -2.100 0.000
ovarian cancer 1.100 0.016

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18821565 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MLPGVGVFGTSLTARVIIPLLKDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCIN      1 - 70
LPPPLTRQIAVKTLGIGKNVICDRTATPLDAFRMTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYV     71 - 140
GEPLVCEVQVHGGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIK    141 - 210
GIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQ    211 - 280
DATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTI    281 - 350
KRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC                                  351 - 390
//

Publication (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...