Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.86
PubTator Score 0.06

Knowledge Summary


No data available


  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -1.600 2.1e-04
astrocytic glioma -2.200 3.3e-03
Astrocytoma, Pilocytic -1.500 1.3e-06
atypical teratoid / rhabdoid tumor -2.300 1.3e-08
breast carcinoma -1.500 6.4e-04
cystic fibrosis 1.177 2.9e-04
ductal carcinoma in situ -1.100 1.2e-02
ependymoma -2.200 7.4e-03
glioblastoma -1.400 1.2e-05
group 3 medulloblastoma -1.200 1.9e-02
invasive ductal carcinoma -1.700 5.4e-04
lung adenocarcinoma -2.600 1.2e-16
lung cancer -1.500 1.6e-03
malignant mesothelioma -2.800 1.6e-07
medulloblastoma, large-cell -1.800 2.2e-04
non-small cell lung cancer -1.052 1.4e-06
oligodendroglioma -2.100 5.3e-03
osteosarcoma -1.946 5.2e-04
ovarian cancer 1.100 1.6e-02
primitive neuroectodermal tumor -1.700 1.8e-04
psoriasis 1.100 1.8e-04
pulmonary arterial hypertension -2.200 4.3e-02
subependymal giant cell astrocytoma -1.814 5.0e-02


Accession Q9NXC2 A8E4L6 Q5T058 Q96JD4 Q9H5K2
Symbols ADG-90


PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (2)

AA Sequence

KRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC                                  351 - 390

Text Mined References (11)

PMID Year Title