Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.86
PubTator Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 1.17197798267655E-16
pediatric high grade glioma 2712 1.73147312594528E-9
glioblastoma 5572 1.95902368230189E-9
pilocytic astrocytoma 3086 1.14000948129345E-8
medulloblastoma 1524 2.26610655158738E-8
malignant mesothelioma 3163 1.63202739307582E-7
non-small cell lung cancer 2798 1.4173363042095E-6
atypical teratoid / rhabdoid tumor 4369 9.17458882037893E-6
medulloblastoma, large-cell 6234 1.99796757926976E-5
psoriasis 6685 1.81710369915507E-4
primitive neuroectodermal tumor 3031 1.82758696366385E-4
cystic fibrosis 1670 2.91468911708873E-4
invasive ductal carcinoma 2950 3.26473091272379E-4
osteosarcoma 7933 5.23802172473732E-4
breast carcinoma 1614 6.35363300035197E-4
ependymoma 2514 0.00159419382661764
lung cancer 4473 0.0016121077838374
astrocytic glioma 2241 0.00333711263052778
oligodendroglioma 2849 0.00525197302193153
ductal carcinoma in situ 1745 0.0119955032295221
ovarian cancer 8492 0.0161657418317577
subependymal giant cell astrocytoma 2287 0.0269591080135445
pulmonary arterial hypertension 36 0.0429239805850597

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -2.800 0.000
astrocytic glioma -2.200 0.003
ependymoma -2.300 0.002
oligodendroglioma -2.100 0.005
psoriasis 1.100 0.000
glioblastoma -3.000 0.000
osteosarcoma -1.946 0.001
medulloblastoma -2.600 0.000
cystic fibrosis 1.177 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -1.700 0.000
non-small cell lung cancer -1.052 0.000
lung cancer -1.500 0.002
breast carcinoma -1.500 0.001
pediatric high grade glioma -2.500 0.000
pilocytic astrocytoma -1.800 0.000
subependymal giant cell astrocytoma -2.281 0.027
lung adenocarcinoma -2.600 0.000
pulmonary arterial hypertension -2.200 0.043
ductal carcinoma in situ -1.100 0.012
invasive ductal carcinoma -2.100 0.000
ovarian cancer 1.100 0.016

Synonym

Accession Q9NXC2 A8E4L6 Q5T058 Q96JD4 Q9H5K2
Symbols ADG-90
C6orf114

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18821565 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MLPGVGVFGTSLTARVIIPLLKDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCIN      1 - 70
LPPPLTRQIAVKTLGIGKNVICDRTATPLDAFRMTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYV     71 - 140
GEPLVCEVQVHGGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIK    141 - 210
GIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQ    211 - 280
DATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTI    281 - 350
KRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC                                  351 - 390
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...