Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.73
PubTator Score 11.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.200 0.001
osteosarcoma -1.009 0.000
lung cancer 1.100 0.038

Synonym

Accession Q9NX74 A8K3G3 Q4H4D9
Symbols SMM1
DUS2L
URLC8

Gene

PDB

4WFS   4WFT   4XP7  

Gene RIF (5)

PMID Text
26429968 This is the first reported case of a tRNA-modifying enzyme (dihydrouridine synthase 2) carrying a dsRNA binding domain used to bind tRNAs.
26143927 Here, the X-ray crystal structure of a construct of hDus2 encompassing the catalytic and tRNA-recognition domains (residues 1-340) determined at 1.9 A resolution is presented.
22442237 crystals belonged to space group P2(1) and contained a single molecule of HsDus2L in the asymmetric unit
20877624 Observational study of gene-disease association. (HuGE Navigator)
18096616 hDUS2 interacts with protein kinase PKR through its dsRNA binding/dimerization domain and inhibits its kinase activity.

AA Sequence

MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVLSTVDFVAPDD      1 - 70
RVVFRTCEREQNRVVFQMGTSDAERALAVARLVENDVAGIDVNMGCPKQYSTKGGMGAALLSDPDKIEKI     71 - 140
LSTLVKGTRRPVTCKIRILPSLEDTLSLVKRIERTGIAAIAVHGRKREERPQHPVSCEVIKAIADTLSIP    141 - 210
VIANGGSHDHIQQYSDIEDFRQATAASSVMVARAAMWNPSIFLKEGLRPLEEVMQKYIRYAVQYDNHYTN    211 - 280
TKYCLCQMLREQLESPQGRLLHAAQSSREICEAFGLGAFYEETTQELDAQQARLSAKTSEQTGEPAEDTS    281 - 350
GVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKK    351 - 420
LAEQAAAIVCLRSQGLPEGRLGEESPSLHKRKREAPDQDPGGPRAQELAQPGDLCKKPFVALGSGEESPL    421 - 490
EGW                                                                       491 - 493
//

Publication (19)

PMID Year Title
26429968 2015 An extended dsRBD is required for post-transcriptional modification in human tRNAs.
26143927 2015 From bacterial to human dihydrouridine synthase: automated structure determination.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22741570 2012 Molecular evolution of dihydrouridine synthases.
22442237 2012 Crystallization and preliminary X-ray crystallographic analysis of the catalytic domain of human dihydrouridine synthase.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...