Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.73
PubTator Score 11.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.3e-04
psoriasis 6694 1.0e-03
lung cancer 4740 3.8e-02
Disease Target Count Z-score Confidence
Kabuki syndrome 27 3.474 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.100 3.8e-02
osteosarcoma -1.009 1.3e-04
psoriasis 1.200 1.0e-03

Gene RIF (5)

AA Sequence

MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVLSTVDFVAPDD      1 - 70
RVVFRTCEREQNRVVFQMGTSDAERALAVARLVENDVAGIDVNMGCPKQYSTKGGMGAALLSDPDKIEKI     71 - 140
LSTLVKGTRRPVTCKIRILPSLEDTLSLVKRIERTGIAAIAVHGRKREERPQHPVSCEVIKAIADTLSIP    141 - 210
VIANGGSHDHIQQYSDIEDFRQATAASSVMVARAAMWNPSIFLKEGLRPLEEVMQKYIRYAVQYDNHYTN    211 - 280
TKYCLCQMLREQLESPQGRLLHAAQSSREICEAFGLGAFYEETTQELDAQQARLSAKTSEQTGEPAEDTS    281 - 350
GVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKK    351 - 420
LAEQAAAIVCLRSQGLPEGRLGEESPSLHKRKREAPDQDPGGPRAQELAQPGDLCKKPFVALGSGEESPL    421 - 490
EGW                                                                       491 - 493
//

Text Mined References (19)

PMID Year Title