Property Summary

NCBI Gene PubMed Count 9
PubMed Score 56.37
PubTator Score 88.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 0.0298097697731907

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.133 0.030

Synonym

Accession Q9NX70 B4DNQ6 M0R2E4 Q5XX09 Q9NTF4
Symbols IXL
MED2

Gene

  Ortholog (12)

Gene RIF (5)

PMID Text
17332321 IXL is required for cancer cell survival in 19q13-amplified tumors.
15555573 Overexpression of IXL in COS-7 cells inhibits the transcriptional activities of SRE and AP-1, suggesting that the IXL protein may act as a transcriptional suppressor in mitogen-activated protein kinase signaling pathway to mediate cellular functions.
15175163 IXL is a subunit of the mammalian Mediator complex.
14576168 A mammalian homolog of Drosophila melanogaster transcriptional coactivator intersex is a subunit of the mammalian Mediator complex
14576168 IXL is a subunit of the mammalian Mediator complex.

AA Sequence

MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKES      1 - 70
LQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTL     71 - 140
VPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKTPAPPAGPGGTL              141 - 200
//

Text Mined References (14)

PMID Year Title
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
21729782 2011 Human mediator subunit MED26 functions as a docking site for transcription elongation factors.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17332321 2007 Intersex-like (IXL) is a cell survival regulator in pancreatic cancer with 19q13 amplification.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15555573 2004 IXL, a new subunit of the mammalian Mediator complex, functions as a transcriptional suppressor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...