Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
R01 Count 1
Funding $78,010.25
PubMed Score 56.37
PubTator Score 88.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.133 0.030

Synonym

Accession Q9NX70 B4DNQ6 M0R2E4 Q5XX09 Q9NTF4
Symbols IXL
MED2

Gene

 Grant Application (2)

Gene RIF (5)

PMID Text
17332321 IXL is required for cancer cell survival in 19q13-amplified tumors.
15555573 Overexpression of IXL in COS-7 cells inhibits the transcriptional activities of SRE and AP-1, suggesting that the IXL protein may act as a transcriptional suppressor in mitogen-activated protein kinase signaling pathway to mediate cellular functions.
15175163 IXL is a subunit of the mammalian Mediator complex.
14576168 A mammalian homolog of Drosophila melanogaster transcriptional coactivator intersex is a subunit of the mammalian Mediator complex
14576168 IXL is a subunit of the mammalian Mediator complex.

AA Sequence

MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKES      1 - 70
LQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTL     71 - 140
VPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKTPAPPAGPGGTL              141 - 200
//

Publication (14)

PMID Year Title
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
21729782 2011 Human mediator subunit MED26 functions as a docking site for transcription elongation factors.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17332321 2007 Intersex-like (IXL) is a cell survival regulator in pancreatic cancer with 19q13 amplification.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15555573 2004 IXL, a new subunit of the mammalian Mediator complex, functions as a transcriptional suppressor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...