Property Summary

NCBI Gene PubMed Count 9
PubMed Score 56.01
PubTator Score 88.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.0e-02

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.133 3.0e-02

Gene RIF (5)

AA Sequence

MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKES      1 - 70
LQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTL     71 - 140
VPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKTPAPPAGPGGTL              141 - 200
//

Text Mined References (14)

PMID Year Title