Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.91
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.20435754628608E-4
medulloblastoma, large-cell 6234 1.63088056573617E-4
ependymoma 2514 0.00555365254925516
Disease Target Count Z-score Confidence
Werner syndrome 29 3.463 1.7

AA Sequence

MFSKCNTPASRAPGTASAPPGTLMALPGTDTAPPPRTASVPPGTASAPPGTLMALPGTDTAPPPRTASVP      1 - 70
PGTASAPPGTLMALPGTDTAPRQNRHGARWNTNGPPWNSLGAPWNTNGPPWNRHGAPPQNSLDAPWNSLG     71 - 140
APWNSLGAPWNSLVLLEQTQPPQNRHSTPWNSLALPGMATSPHPFCAALGICPYMVRVQLCQQGQLHKRP    141 - 210
QLSPPQWAPLLRLWVSFFPGGVLAPVLAPPRCLDTCPCHPGH                                211 - 252
//

Text Mined References (6)

PMID Year Title
19060904 2009 An empirical framework for binary interactome mapping.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.