Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.91
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Werner syndrome 29 3.496 1.7

Synonym

Accession Q9NX53 Q6P1M1 Q8IXT8
Symbols mut-7

Gene

  Ortholog (1)

Species Source Disease
Dog OMA EggNOG Inparanoid

AA Sequence

MFSKCNTPASRAPGTASAPPGTLMALPGTDTAPPPRTASVPPGTASAPPGTLMALPGTDTAPPPRTASVP      1 - 70
PGTASAPPGTLMALPGTDTAPRQNRHGARWNTNGPPWNSLGAPWNTNGPPWNRHGAPPQNSLDAPWNSLG     71 - 140
APWNSLGAPWNSLVLLEQTQPPQNRHSTPWNSLALPGMATSPHPFCAALGICPYMVRVQLCQQGQLHKRP    141 - 210
QLSPPQWAPLLRLWVSFFPGGVLAPVLAPPRCLDTCPCHPGH                                211 - 252
//

Text Mined References (6)

PMID Year Title