Property Summary

NCBI Gene PubMed Count 25
PubMed Score 33.25
PubTator Score 96.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 2.7e-05
esophageal adenocarcinoma -1.500 2.9e-02
lung cancer 1.200 2.0e-03
osteosarcoma -1.452 5.6e-04
ovarian cancer 1.400 2.3e-04
psoriasis 1.100 6.3e-04
tuberculosis and treatment for 6 months 1.200 2.9e-04

Gene RIF (16)

AA Sequence

MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNA      1 - 70
EYLIVFPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVVGHKEGLDVMERADPL     71 - 140
FLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQILNSIFPGIGCPVPRIPAEANPLADHVSATRIL    141 - 210
CGALVFPTIATIVGKLMFSSVNSNLQRTILGGIAFVAIKGAFKVYFKQQQYLRQAHRKILNYPEQEEA      211 - 278
//

Text Mined References (29)

PMID Year Title