Property Summary

NCBI Gene PubMed Count 21
Grant Count 7
R01 Count 6
Funding $920,482.83
PubMed Score 29.84
PubTator Score 96.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
esophageal adenocarcinoma -1.500 0.029
psoriasis 1.100 0.001
osteosarcoma -1.452 0.001
tuberculosis and treatment for 6 months 1.200 0.000
lung cancer 1.200 0.002
atypical teratoid/rhabdoid tumor 1.100 0.000
ovarian cancer 1.400 0.000

Gene RIF (13)

PMID Text
26476016 Self-clearance mechanism of mitochondrial ligase MARCH5 contributes to mitochondria quality control.MARCH5 is regulated by auto-ubiquitination.
26246171 MARCH5 binds MAVS only during viral stimulation when MAVS forms aggregates, and these interactions require the RING domain of MARCH5 and the CARD domain of MAVS.
26210454 Our results indicate that HDAC6 is a critical regulator of MFN2 degradation by MARCH5, thus protecting mitochondrial connectivity from hypoxic stress.
24722297 A fine balance of Mfn1 levels is maintained by MARCH5-mediated quality control on acetylated Mfn1.
23727017 MITOL regulates ER tethering to mitochondria by activating Mfn2 via K192 ubiquitination.
22308378 balance between LC1 activation by S-nitrosylation and down-regulation by MITOL is critical for neuronal cell survival
21625535 MARCH5 is an authentic E3 ubiquitin ligase and catalyzes K63-linked polyubiquitination of TANK. MARCH5 modulates TLR7 signaling via releasing the inhibitory action of TANK toward TRAF6.
20851218 study found that MITOL interacts with and ubiquitinates DeltaNAT-3Q71, a pathogenic ataxin-3 mutant, in mitochondria and attenuates its toxicity
20103533 lack of MARCH5 results in mitochondrial elongation, which promotes cellular senescence by blocking Drp1 activity and/or promoting accumulation of Mfn1 at the mitochondria
19741096 Results indicate that MITOL plays a protective role against mitochondrial dysfunction caused by the mitochondrial accumulation of mSOD1 via the ubiquitin-proteasome pathway.
More...

AA Sequence

MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNA      1 - 70
EYLIVFPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVVGHKEGLDVMERADPL     71 - 140
FLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQILNSIFPGIGCPVPRIPAEANPLADHVSATRIL    141 - 210
CGALVFPTIATIVGKLMFSSVNSNLQRTILGGIAFVAIKGAFKVYFKQQQYLRQAHRKILNYPEQEEA      211 - 278
//

Publication (25)

PMID Year Title
26476016 2016 Self-clearance mechanism of mitochondrial E3 ligase MARCH5 contributes to mitochondria quality control.
26246171 2015 The mitochondrial ubiquitin ligase MARCH5 resolves MAVS aggregates during antiviral signalling.
26210454 2015 HDAC6 maintains mitochondrial connectivity under hypoxic stress by suppressing MARCH5/MITOL dependent MFN2 degradation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24722297 2014 MARCH5-mediated quality control on acetylated Mfn1 facilitates mitochondrial homeostasis and cell survival.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23727017 2013 MITOL regulates endoplasmic reticulum-mitochondria contacts via Mitofusin2.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22308378 2012 Mitochondrial ubiquitin ligase MITOL blocks S-nitrosylated MAP1B-light chain 1-mediated mitochondrial dysfunction and neuronal cell death.
More...