Property Summary

NCBI Gene PubMed Count 6
PubMed Score 31.02
PubTator Score 13.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.100 3.6e-09

Synonym

Accession Q9NX38 Q5JTR0 Q5JTR1
Symbols CG-8
C9orf6
Simiate

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MATEPEAAEPVVPSLVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQSGKTIKSISYQI      1 - 70
STNCSRLQNKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTVSSCVRGRLMEVNENILHKPSILQEKPSTE     71 - 140
GYIAVVLPKFEESKSITEGLLTQKQYEEVMVKRINATTATS                                 141 - 181
//

Text Mined References (9)

PMID Year Title