Property Summary

NCBI Gene PubMed Count 6
PubMed Score 31.02
PubTator Score 13.17

Knowledge Summary


No data available


  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.100 3.6e-09

AA Sequence

GYIAVVLPKFEESKSITEGLLTQKQYEEVMVKRINATTATS                                 141 - 181

Text Mined References (9)

PMID Year Title