Property Summary

NCBI Gene PubMed Count 6
PubMed Score 25.87
PubTator Score 13.17

Knowledge Summary


No data available


  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.100 0.000

AA Sequence

GYIAVVLPKFEESKSITEGLLTQKQYEEVMVKRINATTATS                                 141 - 181

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24782708 2014 Simiate is an Actin binding protein involved in filopodia dynamics and arborization of neurons.
24349419 2013 Identification and characterisation of Simiate, a novel protein linked to the fragile X syndrome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15607035 2004 Systematic identification of hepatocellular proteins interacting with NS5A of the hepatitis C virus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.