Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.47
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 1.4e-27
osteosarcoma 7950 3.2e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Retinitis pigmentosa 4 38 4.573 2.3
Chickenpox 8 3.826 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.300 1.4e-27
osteosarcoma -1.171 3.2e-05

AA Sequence

MNTMYVMMAQILRSHLIKATVIPNRVKMLPYFGIIRNRMMSTHKSKKKIREYYRLLNVEEGCSADEVRES      1 - 70
FHKLAKQYHPDSGSNTADSATFIRIEKAYRKVLSHVIEQTNASQSKGEEEEDVEKFKYKTPQHRHYLSFE     71 - 140
GIGFGTPTQREKHYRQFRADRAAEQVMEYQKQKLQSQYFPDSVIVKNIRQSKQQKITQAIERLVEDLIQE    141 - 210
SMAKGDFDNLSGKGKPLKKFSDCSYIDPMTHNLNRILIDNGYQPEWILKQKEISDTIEQLREAILVSRKK    211 - 280
LGNPMTPTEKKQWNHVCEQFQENIRKLNKRINDFNLIVPILTRQKVHFDAQKEIVRAQKIYETLIKTKEV    281 - 350
TDRNPNNLDQGEGEKTPEIKKGFLNWMNLWKFIKIRSF                                    351 - 388
//

Text Mined References (10)

PMID Year Title