Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.47
PubTator Score 0.07

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 1.4e-27
osteosarcoma 7950 3.2e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Retinitis pigmentosa 4 38 4.573 2.3
Chickenpox 8 3.826 1.9


  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.300 1.4e-27
osteosarcoma -1.171 3.2e-05


Accession Q9NX36 D3DSF2
Symbols C21orf55


PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

AA Sequence

TDRNPNNLDQGEGEKTPEIKKGFLNWMNLWKFIKIRSF                                    351 - 388

Text Mined References (10)

PMID Year Title