Property Summary

NCBI Gene PubMed Count 10
Grant Count 2
R01 Count 1
Funding $1,497,890.33
PubMed Score 1.67
PubTator Score 0.14

Knowledge Summary


No data available


  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.115 0.001
osteosarcoma -1.394 0.000
non primary Sjogren syndrome sicca 1.100 0.037
ovarian cancer 1.900 0.000


Accession Q9NX20 Q9BYD0 Q9HB70 L16mt
Symbols L16mt


 Grant Application (2)


3J9M   3J7Y  

Gene RIF (1)

20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

NPWTFERIATANMLGIRKVLSPYDLTHKGKYWGKFYMPKRV                                 211 - 251

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11551941 2001 The large subunit of the mammalian mitochondrial ribosome. Analysis of the complement of ribosomal proteins present.