Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.67
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 3.7e-02
osteosarcoma -1.394 2.7e-06
ovarian cancer -1.200 7.2e-06
Waldenstrons macroglobulinemia 1.115 6.3e-04

Gene RIF (1)

AA Sequence

MWRLLARASAPLLRVPLSDSWALLPASAGVKTLLPVPSFEDVSIPEKPKLRFIERAPLVPKVRREPKNLS      1 - 70
DIRGPSTEATEFTEGNFAILALGGGYLHWGHFEMMRLTINRSMDPKNMFAIWRVPAPFKPITRKSVGHRM     71 - 140
GGGKGAIDHYVTPVKAGRLVVEMGGRCEFEEVQGFLDQVAHKLPFAAKAVSRGTLEKMRKDQEERERNNQ    141 - 210
NPWTFERIATANMLGIRKVLSPYDLTHKGKYWGKFYMPKRV                                 211 - 251
//

Text Mined References (13)

PMID Year Title