Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.17
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
hereditary spastic paraplegia -1.192 7.5e-03
lung cancer 1.500 9.6e-04
ovarian cancer -1.400 5.1e-04
primary Sjogren syndrome 1.300 9.3e-04
Waldenstrons macroglobulinemia 1.119 2.5e-02

Gene RIF (1)

AA Sequence

MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNL      1 - 70
PDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPL     71 - 140
LSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK                               141 - 183
//

Text Mined References (13)

PMID Year Title