Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.99
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NX04 D3DPT1 Q8WVD1
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MTQDRPLLAVQEALKKCFPVVEEQQGLWQSALRDCQPLLSSLSNLAEQLQAAQNLRFEDVPALRAFPDLK      1 - 70
ERLRRKQLVAGDIVLDKLGERLAILLKVRDMVSSHVERVFQIYEQHADTVGIDAVLQPSAVSPSVADMLE     71 - 140
WLQDIERHYRKSYLKRKYLLSSIQWGDLANIQALPKAWDRISKDEHQDLVQDILLNVSFFLEE           141 - 203
//

Text Mined References (10)

PMID Year Title