Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.99
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NX04 D3DPT1 Q8WVD1
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
22548824 our findings suggest that C1ORF109 may be the downstream target of protein kinase CK2 and involved in the regulation of cancer cell proliferation.

AA Sequence

MTQDRPLLAVQEALKKCFPVVEEQQGLWQSALRDCQPLLSSLSNLAEQLQAAQNLRFEDVPALRAFPDLK      1 - 70
ERLRRKQLVAGDIVLDKLGERLAILLKVRDMVSSHVERVFQIYEQHADTVGIDAVLQPSAVSPSVADMLE     71 - 140
WLQDIERHYRKSYLKRKYLLSSIQWGDLANIQALPKAWDRISKDEHQDLVQDILLNVSFFLEE           141 - 203
//

Publication (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
22548824 2012 Identification and characterization of a novel gene, c1orf109, encoding a CK2 substrate that is involved in cancer cell proliferation.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.