Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.97
PubTator Score 2.49

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.0330990704941E-8
posterior fossa group B ependymoma 1530 1.96531875330423E-7
ovarian cancer 8492 4.24339937239538E-7
malignant mesothelioma 3163 9.94712563379071E-7
psoriasis 6685 1.1331451490388E-4
Disease Target Count Z-score Confidence
Muscular atrophy 67 4.058 2.0


  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
psoriasis -2.600 0.000
osteosarcoma -2.187 0.000
posterior fossa group B ependymoma 1.100 0.000
ovarian cancer -1.300 0.000


Accession Q9NWZ8 C4AMC4 Q2LJ66 Q6ZV27 Gemin-8
Symbols FAM51A1


  Ortholog (15)

Gene RIF (2)

17023415 Gemin8 has an essential role in the proper structural organization of the SMN complex and the involvement of the heteromeric subunit containing Gemin6, Gemin7, Gemin8, and Unrip in the recruitment of Sm proteins to the snRNP assembly pathway
16434402 Gemin8 is a novel integral component of the SMN complex

AA Sequence

KIQAMEAAVQLSFDKHCDRKQPKYWPVIPLKF                                          211 - 242

Text Mined References (10)

PMID Year Title
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17023415 2006 Gemin8 is required for the architecture and function of the survival motor neuron complex.
16434402 2006 Gemin8 is a novel component of the survival motor neuron complex and functions in small nuclear ribonucleoprotein assembly.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.