Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.97
PubTator Score 2.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
psoriasis -2.600 0.000
osteosarcoma -2.187 0.000
posterior fossa group B ependymoma 1.100 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q9NWZ8 C4AMC4 Q2LJ66 Q6ZV27 Gemin-8
Symbols FAM51A1

Gene

Gene RIF (2)

PMID Text
17023415 Gemin8 has an essential role in the proper structural organization of the SMN complex and the involvement of the heteromeric subunit containing Gemin6, Gemin7, Gemin8, and Unrip in the recruitment of Sm proteins to the snRNP assembly pathway
16434402 Gemin8 is a novel integral component of the SMN complex

AA Sequence

MAAVKASTSKATRPWYSHPVYARYWQHYHQAMAWMQSHHNAYRKAVESCFNLPWYLPSALLPQSSYDNEA      1 - 70
AYPQSFYDHHVAWQDYPCSSSHFRRSGQHPRYSSRIQASTKEDQALSKEEEMETESDAEVECDLSNMEIT     71 - 140
EELRQYFAETERHREERRRQQQLDAERLDSYVNADHDLYCNTRRSVEAPTERPGERRQAEMKRLYGDSAA    141 - 210
KIQAMEAAVQLSFDKHCDRKQPKYWPVIPLKF                                          211 - 242
//

Publication (10)

PMID Year Title
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17023415 2006 Gemin8 is required for the architecture and function of the survival motor neuron complex.
16434402 2006 Gemin8 is a novel component of the survival motor neuron complex and functions in small nuclear ribonucleoprotein assembly.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.