Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.19
PubTator Score 2.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.400 9.9e-07
osteosarcoma -2.187 1.0e-08
ovarian cancer -1.300 4.2e-07
posterior fossa group B ependymoma 1.100 2.0e-07
psoriasis -2.600 1.1e-04

Gene RIF (2)

AA Sequence

MAAVKASTSKATRPWYSHPVYARYWQHYHQAMAWMQSHHNAYRKAVESCFNLPWYLPSALLPQSSYDNEA      1 - 70
AYPQSFYDHHVAWQDYPCSSSHFRRSGQHPRYSSRIQASTKEDQALSKEEEMETESDAEVECDLSNMEIT     71 - 140
EELRQYFAETERHREERRRQQQLDAERLDSYVNADHDLYCNTRRSVEAPTERPGERRQAEMKRLYGDSAA    141 - 210
KIQAMEAAVQLSFDKHCDRKQPKYWPVIPLKF                                          211 - 242
//

Text Mined References (10)

PMID Year Title