Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.37
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 5.5e-07
dermatomyositis 966 9.8e-04
acute myeloid leukemia 783 2.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.700 2.8e-02
dermatomyositis 1.200 9.8e-04
ovarian cancer -1.900 5.5e-07

Synonym

Accession Q9NWY4
Symbols C4orf27

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MVGGGGKRRPGGEGPQCEKTTDVKKSKFCEADVSSDLRKEVENHYKLSLPEDFYHFWKFCEELDPEKPSD      1 - 70
SLSASLGLQLVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTIIIGDNKTQYHMGYFRDSPDEFP     71 - 140
VYVGINEAKKNCIIVPNGDNVFAAVKLFLTKKLREITDKKKINLLKNIDEKLTEAARELGYSLEQRTVKM    141 - 210
KQRDKKVVTKTFHGAGLVVPVDKNDVGYRELPETDADLKRICKTIVEAASDEERLKAFAPIQEMMTFVQF    211 - 280
ANDECDYGMGLELGMDLFCYGSHYFHKVAGQLLPLAYNLLKRNLFAEIIEEHLANRSQENIDQLAA        281 - 346
//

Text Mined References (18)

PMID Year Title