Property Summary

NCBI Gene PubMed Count 13
Grant Count 10
R01 Count 10
Funding $2,493,549.5
PubMed Score 146.98
PubTator Score 64.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (6)

PMID Text
26792895 PARI inhibits homologous recombination in vivo, and its knockdown suppresses the UV sensitivity of RAD18-depleted cells
23436799 PARI overexpression promotes genomic instability and pancreatic tumorigenesis.
23039964 Knockdown of C12orf48 by siRNA in HeLa cells significantly suppressed their growth
22153967 PARI suppresses inappropriate recombination events at mammalian replication forks.
20931645 Demonstrated that C12orf48 protein could directly interact with Poly(ADP-ribose) Polymerase-1 (PARP-1). Knockdown of C12orf48 by siRNA in PDAC cells significantly suppressed their growth.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAVFNQKSVSDMIKEFRKNWRALCNSERTTLCGADSMLLALQLSMAENNKQHSGEFTVSLSDVLLTWKYL      1 - 70
LHEKLNLPVENMDVTDHYEDVRKIYDDFLKNSNMLDLIDVYQKCRALTSNCENYNTVSPSQLLDFLSGKQ     71 - 140
YAVGDETDLSIPTSPTSKYNRDNEKVQLLARKIIFSYLNLLVNSKNDLAVAYILNIPDRGLGREAFTDLK    141 - 210
HAAREKQMSIFLVATSFIRTIELGGKGYAPPPSDPLRTHVKGLSNFINFIDKLDEILGEIPNPSIAGGQI    211 - 280
LSVIKMQLIKGQNSRDPFCKAIEEVAQDLDLRIKNIINSQEGVVALSTTDISPARPKSHAINHGTAYCGR    281 - 350
DTVKALLVLLDEEAANAPTKNKAELLYDEENTIHHHGTSILTLFRSPTQVNNSIKPLRERICVSMQEKKI    351 - 420
KMKQTLIRSQFACTYKDDYMISKDNWNNVNLASKPLCVLYMENDLSEGVNPSVGRSTIGTSFGNVHLDRS    421 - 490
KNEKVSRKSTSQTGNKSSKRKQVDLDGENILCDNRNEPPQHKNAKIPKKSNDSQNRLYGKLAKVAKSNKC    491 - 560
TAKDKLISGQAKLTQFFRL                                                       561 - 579
//

Text Mined References (14)

PMID Year Title
26792895 2016 The PCNA-associated protein PARI negatively regulates homologous recombination via the inhibition of DNA repair synthesis.
24396997 2013 Meta-analysis of the cell cycle related C12orf48.
23436799 2013 PARI overexpression promotes genomic instability and pancreatic tumorigenesis.
23039964 2012 GeneFriends: an online co-expression analysis tool to identify novel gene targets for aging and complex diseases.
22153967 2012 Inhibition of homologous recombination by the PCNA-interacting protein PARI.
20931645 2011 C12orf48, termed PARP-1 binding protein, enhances poly(ADP-ribose) polymerase-1 (PARP-1) activity and protects pancreatic cancer cells from DNA damage.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
More...