Property Summary

NCBI Gene PubMed Count 14
PubMed Score 141.27
PubTator Score 64.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 1.037 1.3e-02
adrenocortical carcinoma 1.115 3.9e-03
atypical teratoid / rhabdoid tumor 1.500 2.2e-04
Breast cancer 1.300 2.6e-06
colon cancer 1.700 3.5e-02
glioblastoma 1.200 1.7e-05
group 3 medulloblastoma 2.200 9.0e-06
intraductal papillary-mucinous neoplasm ... 1.200 4.8e-03
lung cancer 4.500 8.6e-08
malignant mesothelioma 1.200 9.1e-07
medulloblastoma, large-cell 2.100 1.0e-05
nasopharyngeal carcinoma 1.400 2.0e-05
non-small cell lung cancer 1.425 3.1e-18
osteosarcoma -2.148 7.9e-03
ovarian cancer 1.300 1.5e-03
pediatric high grade glioma 1.400 4.7e-05
primitive neuroectodermal tumor 1.400 6.3e-03
psoriasis 1.500 1.0e-56

Gene RIF (7)

AA Sequence

MAVFNQKSVSDMIKEFRKNWRALCNSERTTLCGADSMLLALQLSMAENNKQHSGEFTVSLSDVLLTWKYL      1 - 70
LHEKLNLPVENMDVTDHYEDVRKIYDDFLKNSNMLDLIDVYQKCRALTSNCENYNTVSPSQLLDFLSGKQ     71 - 140
YAVGDETDLSIPTSPTSKYNRDNEKVQLLARKIIFSYLNLLVNSKNDLAVAYILNIPDRGLGREAFTDLK    141 - 210
HAAREKQMSIFLVATSFIRTIELGGKGYAPPPSDPLRTHVKGLSNFINFIDKLDEILGEIPNPSIAGGQI    211 - 280
LSVIKMQLIKGQNSRDPFCKAIEEVAQDLDLRIKNIINSQEGVVALSTTDISPARPKSHAINHGTAYCGR    281 - 350
DTVKALLVLLDEEAANAPTKNKAELLYDEENTIHHHGTSILTLFRSPTQVNNSIKPLRERICVSMQEKKI    351 - 420
KMKQTLIRSQFACTYKDDYMISKDNWNNVNLASKPLCVLYMENDLSEGVNPSVGRSTIGTSFGNVHLDRS    421 - 490
KNEKVSRKSTSQTGNKSSKRKQVDLDGENILCDNRNEPPQHKNAKIPKKSNDSQNRLYGKLAKVAKSNKC    491 - 560
TAKDKLISGQAKLTQFFRL                                                       561 - 579
//

Text Mined References (15)

PMID Year Title