Property Summary

NCBI Gene PubMed Count 13
PubMed Score 146.98
PubTator Score 64.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
psoriasis 6685 1.01353386039104E-56
non-small cell lung cancer 2798 3.06757970384535E-18
lung cancer 4473 8.58706567593029E-8
malignant mesothelioma 3163 9.12219636909739E-7
group 3 medulloblastoma 2254 1.05936846076725E-6
Breast cancer 3099 2.58498492598228E-6
medulloblastoma, large-cell 6234 6.05632040675791E-6
nasopharyngeal carcinoma 1056 6.91452483839815E-6
atypical teratoid / rhabdoid tumor 4369 1.92959014119199E-5
pediatric high grade glioma 2712 4.67394820338197E-5
primitive neuroectodermal tumor 3031 5.77382503673464E-4
glioblastoma 5572 6.02612102848882E-4
adrenocortical carcinoma 1427 9.3729044694987E-4
ovarian cancer 8492 0.00152120779233562
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00483063127599883
osteosarcoma 7933 0.00785261020056581
active Crohn's disease 918 0.013219629658636
colon cancer 1475 0.0354677918101914

Expression

  Differential Expression (18)

Synonym

Accession Q9NWS1 B4E0Y0 Q05C00 Q499L8 Q4FZA0 Q4KMW7 Q6NSC6 Q6PJA1 Q86W36 PARI
Symbols AROM
PARI
C12orf48

Gene

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (6)

PMID Text
26792895 PARI inhibits homologous recombination in vivo, and its knockdown suppresses the UV sensitivity of RAD18-depleted cells
23436799 PARI overexpression promotes genomic instability and pancreatic tumorigenesis.
23039964 Knockdown of C12orf48 by siRNA in HeLa cells significantly suppressed their growth
22153967 PARI suppresses inappropriate recombination events at mammalian replication forks.
20931645 Demonstrated that C12orf48 protein could directly interact with Poly(ADP-ribose) Polymerase-1 (PARP-1). Knockdown of C12orf48 by siRNA in PDAC cells significantly suppressed their growth.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAVFNQKSVSDMIKEFRKNWRALCNSERTTLCGADSMLLALQLSMAENNKQHSGEFTVSLSDVLLTWKYL      1 - 70
LHEKLNLPVENMDVTDHYEDVRKIYDDFLKNSNMLDLIDVYQKCRALTSNCENYNTVSPSQLLDFLSGKQ     71 - 140
YAVGDETDLSIPTSPTSKYNRDNEKVQLLARKIIFSYLNLLVNSKNDLAVAYILNIPDRGLGREAFTDLK    141 - 210
HAAREKQMSIFLVATSFIRTIELGGKGYAPPPSDPLRTHVKGLSNFINFIDKLDEILGEIPNPSIAGGQI    211 - 280
LSVIKMQLIKGQNSRDPFCKAIEEVAQDLDLRIKNIINSQEGVVALSTTDISPARPKSHAINHGTAYCGR    281 - 350
DTVKALLVLLDEEAANAPTKNKAELLYDEENTIHHHGTSILTLFRSPTQVNNSIKPLRERICVSMQEKKI    351 - 420
KMKQTLIRSQFACTYKDDYMISKDNWNNVNLASKPLCVLYMENDLSEGVNPSVGRSTIGTSFGNVHLDRS    421 - 490
KNEKVSRKSTSQTGNKSSKRKQVDLDGENILCDNRNEPPQHKNAKIPKKSNDSQNRLYGKLAKVAKSNKC    491 - 560
TAKDKLISGQAKLTQFFRL                                                       561 - 579
//

Text Mined References (14)

PMID Year Title
26792895 2016 The PCNA-associated protein PARI negatively regulates homologous recombination via the inhibition of DNA repair synthesis.
24396997 2013 Meta-analysis of the cell cycle related C12orf48.
23436799 2013 PARI overexpression promotes genomic instability and pancreatic tumorigenesis.
23039964 2012 GeneFriends: an online co-expression analysis tool to identify novel gene targets for aging and complex diseases.
22153967 2012 Inhibition of homologous recombination by the PCNA-interacting protein PARI.
20931645 2011 C12orf48, termed PARP-1 binding protein, enhances poly(ADP-ribose) polymerase-1 (PARP-1) activity and protects pancreatic cancer cells from DNA damage.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
More...