Property Summary

NCBI Gene PubMed Count 20
PubMed Score 8.09
PubTator Score 7.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.9e-05
lung cancer 4740 2.0e-03
acute myeloid leukemia 783 4.2e-02

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.300 4.2e-02
lung cancer 1.400 2.0e-03
ovarian cancer 1.400 2.9e-05

Gene RIF (7)

AA Sequence

MANPKLLGMGLSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNSSEGKVFINIC      1 - 70
HSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRE     71 - 140
LVITIAREGLEDKYNLQLNPEWRMMKNRPFMGSISQQNIRSEQRPRIQELGDLYTPAPGRAESGPEKPHL    141 - 210
NLWLEAPDLLLAEVDLPKLDGALGLSLEIGENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLM    211 - 280
VAMPLLPVPS                                                                281 - 290
//

Text Mined References (24)

PMID Year Title