Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.76
PubTator Score 7.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.500 0.000
acute myeloid leukemia -1.300 0.042
ovarian cancer 1.400 0.000

Synonym

Accession Q9NWS0 B4DGN7 B4E2X7 Q9BVL0
Symbols NOP17

Gene

PDB

4PSI   4PSF  

Gene RIF (7)

PMID Text
24656813 We propose that protein complexes assembled by the R2TP complex are defined by phosphorylation of a specific motif and recognition by the PIH1D1 subunit
24036451 PIH1D1 interacts with mTOR complex 1 and enhances ribosome RNA transcription.
23159623 this study investigated the interaction between RPAP3 and PIH1D1.
22368283 Human PIH1 domain-containing protein 1 (PIH1) interacts directly with histone H4 and recruits the Brg1-SWI/SNF complex via SNF5 to human rRNA genes.
21078300 These results suggest that PIH1D1 may also function as a novel modulator of apoptosis pathway.
20078948 PIH1D1 may stabilize SNF5 by attenuating its proteasome degradation pathway.
19450687 Is part of an RNA polymerase II-associated complex with possible chaperone activity.

AA Sequence

MANPKLLGMGLSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNSSEGKVFINIC      1 - 70
HSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRE     71 - 140
LVITIAREGLEDKYNLQLNPEWRMMKNRPFMGSISQQNIRSEQRPRIQELGDLYTPAPGRAESGPEKPHL    141 - 210
NLWLEAPDLLLAEVDLPKLDGALGLSLEIGENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLM    211 - 280
VAMPLLPVPS                                                                281 - 290
//

Text Mined References (22)

PMID Year Title
26711270 2015 A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24656813 2014 Phosphorylation-dependent PIH1D1 interactions define substrate specificity of the R2TP cochaperone complex.
24036451 2013 PIH1D1 interacts with mTOR complex 1 and enhances ribosome RNA transcription.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23159623 2013 RPAP3 splicing variant isoform 1 interacts with PIH1D1 to compose R2TP complex for cell survival.
22368283 2012 Human PIH1 associates with histone H4 to mediate the glucose-dependent enhancement of pre-rRNA synthesis.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
More...