Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.900 0.005
ependymoma -2.100 0.006
oligodendroglioma -1.900 0.004
osteosarcoma -1.307 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.400 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.200 0.001
lung carcinoma 1.100 0.000
Pick disease -1.200 0.000

AA Sequence

METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEWFNKGSMATAA      1 - 70
LPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMNDFRSKMQSIFPTIPKNSESAVEWEETLKS     71 - 140
K//

Publication (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.