Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.900 5.1e-03
atypical teratoid / rhabdoid tumor -1.600 4.1e-08
ependymoma -2.100 6.2e-03
glioblastoma -1.400 1.4e-04
group 4 medulloblastoma -1.100 2.5e-04
lung carcinoma 1.100 3.1e-18
medulloblastoma, large-cell -2.100 5.9e-07
oligodendroglioma -1.900 4.5e-03
osteosarcoma -1.307 1.2e-05
Pick disease -1.200 1.6e-06
primitive neuroectodermal tumor -1.200 7.8e-04

AA Sequence

METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEWFNKGSMATAA      1 - 70
LPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMNDFRSKMQSIFPTIPKNSESAVEWEETLKS     71 - 140
K//

Text Mined References (9)

PMID Year Title