Property Summary

NCBI Gene PubMed Count 29
PubMed Score 17.14
PubTator Score 15.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 0.000

Synonym

Accession Q9NWF9 Q6Y691 Q75ML7 Q7Z2H7 Q7Z7C1 Q8NHW7 Q9NYT1
Symbols ZIN
CAHH
U7I1
TRIAD3
UBCE7IP1

Gene

PANTHER Protein Class (2)

Gene RIF (20)

PMID Text
25841028 Novel RNF216 mutations causing an Huntington-like phenotype with pure monogenic recessive inheritance. .
24945773 Loss of Triad3A mimics and occludes Arc-dependent forms of synaptic plasticity.
23656588 The syndrome of hypogonadotropic hypogonadism, ataxia, and dementia can be caused by inactivating mutations in RNF216 or by the combination of mutations in RNF216 and OTUD4.
21270397 By promoting polyubiquitylation and degradation, E3 ubiquitin ligase Triad3A is identified as an interaction partner for the killer cell Ig-like receptor KIR2DL4 cytoplasmic domain.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19893624 Triad3A represents a versatile E3 ubiquitin ligase that negatively regulates RIG-like receptor signaling by targeting TRAF3 for degradation following RNA virus infection.
19690434 Gene expression of RIPK3 and RNF216 in PBMC could identify those obese subjects, who will regain more weight after a successful initial weight loss. The mRNA levels of these genes could be nutrigenomic biomarkers for predicting obesity treatment outcome.
19149577 Triad 3/ZIN binds to purified HIV-1 Vif in vitro, interacts with HIV-1 Vif in transfected human 293T cells, and can impair viral DNA synthesis by two-fold when overexpressed in cells69
19149577 Triad 3/ZIN binds to purified HIV-1 Vif in vitro, interacts with HIV-1 Vif in transfected human 293T cells, and can impair viral DNA synthesis by two-fold when overexpressed in cells69
More...

AA Sequence

MEEGNNNEEVIHLNNFHCHRGQEWINLRDGPITISDSSDEERIPMLVTPAPQQHEEEDLDDDVILTEDDS      1 - 70
EDDYGEFLDLGPPGISEFTKPSGQTEREPKPGPSHNQAANDIVNPRSEQKVIILEEGSLLYTESDPLETQ     71 - 140
NQSSEDSETELLSNLGESAALADDQAIEEDCWLDHPYFQSLNQQPREITNQVVPQERQPEAELGRLLFQH    141 - 210
EFPGPAFPRPEPQQGGISGPSSPQPAHPLGEFEDQQLASDDEEPGPAFPMQESQEPNLENIWGQEAAEVD    211 - 280
QELVELLVKETEARFPDVANGFIEEIIHFKNYYDLNVLCNFLLENPDYPKREDRIIINPSSSLLASQDET    281 - 350
KLPKIDFFDYSKLTPLDQRCFIQAADLLMADFKVLSSQDIKWALHELKGHYAITRKALSDAIKKWQELSP    351 - 420
ETSGKRKKRKQMNQYSYIDFKFEQGDIKIEKRMFFLENKRRHCRSYDRRALLPAVQQEQEFYEQKIKEMA    421 - 490
EHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCM    491 - 560
EGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRK    561 - 630
ETCRKCQGLWKEHNGLTCEELAEKDDIKYRTSIEEKMTAARIRKCHKCGTGLIKSEGCNRMSCRCGAQMC    631 - 700
YLCRVSINGYDHFCQHPRSPGAPCQECSRCSLWTDPTEDDEKLIEEIQKEAEEEQKRKNGENTFKRIGPP    701 - 770
LEKPVEKVQRVEALPRPVPQNLPQPQMPPYAFAHPPFPLPPVRPVFNNFPLNMGPIPAPYVPPLPNVRVN    771 - 840
YDFGPIHMPLEHNLPMHFGPQPRHRF                                                841 - 866
//

Publication (33)

PMID Year Title
25841028 2015 RNF216 mutations as a novel cause of autosomal recessive Huntington-like disorder.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24945773 2014 Triad3A regulates synaptic strength by ubiquitination of Arc.
23656588 2013 Ataxia, dementia, and hypogonadotropism caused by disordered ubiquitination.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21270397 2011 Ubiquitylation of an internalized killer cell Ig-like receptor by Triad3A disrupts sustained NF-?B signaling.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...