Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.71
PubTator Score 1.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Alzheimer's disease -1.300 1.6e-02
atypical teratoid / rhabdoid tumor -1.200 6.6e-04
Barrett's esophagus -1.500 2.0e-02
Breast cancer -1.400 5.2e-05
colon cancer -1.900 1.9e-04
Common variable immunodeficiency -1.099 2.1e-02
ependymoma -1.600 2.8e-02
esophageal adenocarcinoma -2.100 2.3e-02
glioblastoma multiforme -1.200 1.1e-13
interstitial cystitis -1.100 7.2e-05
intraductal papillary-mucinous neoplasm ... -2.700 8.1e-03
lung adenocarcinoma -1.200 1.2e-15
lung cancer -1.900 6.3e-04
lung carcinoma 1.300 2.0e-20
medulloblastoma, large-cell -1.200 9.5e-04
non-small cell lung cancer -1.216 5.7e-09
osteosarcoma 1.155 4.3e-02
ovarian cancer -1.900 1.1e-04
Pick disease -1.700 9.2e-06
progressive supranuclear palsy -1.300 1.8e-02
psoriasis -1.500 7.6e-08
subependymal giant cell astrocytoma -1.679 1.9e-02

Synonym

Accession Q9NWD9
Symbols BEXL1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRH      1 - 70
IEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP                         71 - 120
//

Text Mined References (7)

PMID Year Title