Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.72
PubTator Score 1.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.02664579422314E-20
glioblastoma multiforme 347 1.05181729884556E-13
non-small cell lung cancer 2798 5.69678064244338E-9
psoriasis 6685 7.61359213566509E-8
lung adenocarcinoma 2714 6.79884672087522E-6
Pick disease 1893 9.16201298634003E-6
lung cancer 4473 1.4920440238965E-5
Breast cancer 3099 5.17658625802965E-5
interstitial cystitis 2299 7.19184897669344E-5
colon cancer 1475 1.86853885393686E-4
atypical teratoid / rhabdoid tumor 4369 6.55464002616066E-4
medulloblastoma, large-cell 6234 9.48698025119585E-4
ovarian cancer 8492 0.0011583717324668
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00811394847489177
Alzheimer's disease 644 0.0163313620240389
progressive supranuclear palsy 674 0.018117245146726
subependymal giant cell astrocytoma 2287 0.0185754893820071
Barrett's esophagus 185 0.0204780914483485
Common variable immunodeficiency 98 0.0211033204035696
esophageal adenocarcinoma 737 0.0234984895973851
ependymoma 2514 0.0282963850749501
osteosarcoma 7933 0.0433629122721595

Expression

  Differential Expression (22)

Disease log2 FC p
ependymoma -1.600 0.028
Barrett's esophagus -1.500 0.020
esophageal adenocarcinoma -2.100 0.023
psoriasis -1.500 0.000
glioblastoma multiforme -1.200 0.000
osteosarcoma 1.155 0.043
atypical teratoid / rhabdoid tumor -1.200 0.001
medulloblastoma, large-cell -1.200 0.001
non-small cell lung cancer -1.216 0.000
Common variable immunodeficiency -1.099 0.021
intraductal papillary-mucinous neoplasm ... -2.700 0.008
lung cancer -2.200 0.000
colon cancer -1.900 0.000
interstitial cystitis -1.100 0.000
lung adenocarcinoma -1.500 0.000
subependymal giant cell astrocytoma -1.679 0.019
lung carcinoma 1.300 0.000
Alzheimer's disease -1.300 0.016
Pick disease -1.700 0.000
progressive supranuclear palsy -1.300 0.018
Breast cancer -1.400 0.000
ovarian cancer 2.100 0.001

Synonym

Accession Q9NWD9
Symbols BEXL1

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Dog OMA EggNOG
Pig OMA EggNOG

AA Sequence

MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRH      1 - 70
IEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP                         71 - 120
//

Text Mined References (5)

PMID Year Title
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15958283 2005 Characterization of the Bex gene family in humans, mice, and rats.
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.