Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.72
PubTator Score 1.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
ependymoma -1.600 0.028
Barrett's esophagus -1.500 0.020
esophageal adenocarcinoma -2.100 0.023
psoriasis -1.500 0.000
glioblastoma multiforme -1.200 0.000
osteosarcoma 1.155 0.043
atypical teratoid / rhabdoid tumor -1.200 0.001
medulloblastoma, large-cell -1.200 0.001
non-small cell lung cancer -1.216 0.000
Common variable immunodeficiency -1.099 0.021
intraductal papillary-mucinous neoplasm ... -2.700 0.008
lung cancer -2.200 0.000
colon cancer -1.900 0.000
interstitial cystitis -1.100 0.000
lung adenocarcinoma -1.500 0.000
subependymal giant cell astrocytoma -1.679 0.019
lung carcinoma 1.300 0.000
Alzheimer's disease -1.300 0.016
Pick disease -1.700 0.000
progressive supranuclear palsy -1.300 0.018
Breast cancer -1.400 0.000
ovarian cancer 2.100 0.001

AA Sequence

MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRH      1 - 70
IEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP                         71 - 120
//

Publication (5)

PMID Year Title
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15958283 2005 Characterization of the Bex gene family in humans, mice, and rats.
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.