Property Summary

NCBI Gene PubMed Count 72
PubMed Score 99.21
PubTator Score 68.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -3.100 1.6e-06
astrocytic glioma -3.000 1.7e-03
Astrocytoma, Pilocytic -3.400 1.4e-10
atypical teratoid / rhabdoid tumor -4.400 1.7e-12
ependymoma -3.200 4.0e-03
glioblastoma -3.600 5.2e-12
medulloblastoma -1.200 1.6e-02
medulloblastoma, large-cell -1.900 2.5e-04
oligodendroglioma -2.800 7.2e-03
osteosarcoma 1.116 1.2e-04
ovarian cancer -1.100 4.8e-05
Pick disease -2.200 1.3e-02
primitive neuroectodermal tumor -3.100 2.2e-03
subependymal giant cell astrocytoma -2.830 8.2e-03

Protein-protein Interaction (11)

Gene RIF (47)

AA Sequence

MNCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQ      1 - 70
THSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSENTENKSQPKRLHVSNIPFRFRDPDLRQMFGQF     71 - 140
GKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTNGWK    141 - 210
LNPVVGAVYSPEFYAGTVLLCQANQEGSSMYSAPSSLVYTSAMPGFPYPAATAAAAYRGAHLRGRGRTVY    211 - 280
NTFRAAAPPPPIPAYGGVVYQDGFYGADIYGGYAAYRYAQPTPATAAAYSDSYGRVYAADPYHHALAPAP    281 - 350
TYGVGAMNAFAPLTDAKTRSHADDVGLVLSSLQASIYRGGYNRFAPY                           351 - 397
//

Text Mined References (74)

PMID Year Title