Property Summary

NCBI Gene PubMed Count 23
PubMed Score 7.53
PubTator Score 3.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 1.06119282869143E-7
ovarian cancer 8492 8.3696785858985E-6
osteosarcoma 7933 2.52755427142765E-5
Multiple myeloma 1328 4.32930638630025E-4
group 3 medulloblastoma 2254 0.0062737769097051
astrocytoma 1493 0.0065132134642326
subependymal giant cell astrocytoma 2287 0.0113937269554996
oligodendroglioma 2849 0.0182833013873731

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.848 0.000
malignant mesothelioma 1.800 0.000
oligodendroglioma 1.100 0.018
osteosarcoma -1.900 0.000
astrocytoma 1.400 0.007
group 3 medulloblastoma 1.100 0.006
subependymal giant cell astrocytoma -1.195 0.011
ovarian cancer -1.300 0.000

Synonym

Accession Q9NW64 A6NDM5 B4DLI9 O95607
Symbols Cwc2
ZC3H16
fSAP47

Gene

PANTHER Protein Class (2)

PDB

2YTC  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (2)

PMID Text
22246180 Cwc2/RBM22-RNA contacts are functionally important.
17045351 ALG-2 alone evenly distributed within the cell, whereas in the presence of RBM22 the two proteins co-localized within the nucleus.

AA Sequence

MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV      1 - 70
CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKA     71 - 140
TSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVA    141 - 210
DKLLKRASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAA    211 - 280
EVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF    281 - 350
NLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP    351 - 420
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22246180 2012 Cwc2 and its human homologue RBM22 promote an active conformation of the spliceosome catalytic centre.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21122810 2011 Stress induced subcellular distribution of ALG-2, RBM22 and hSlu7.
More...