Property Summary

NCBI Gene PubMed Count 23
Grant Count 7
R01 Count 3
Funding $764,237.17
PubMed Score 7.53
PubTator Score 3.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.848 0.000
malignant mesothelioma 1.800 0.000
oligodendroglioma 1.100 0.018
osteosarcoma -1.900 0.000
astrocytoma 1.400 0.007
group 3 medulloblastoma 1.100 0.006
subependymal giant cell astrocytoma -1.195 0.011
ovarian cancer -1.300 0.000

Gene RIF (2)

PMID Text
22246180 Cwc2/RBM22-RNA contacts are functionally important.
17045351 ALG-2 alone evenly distributed within the cell, whereas in the presence of RBM22 the two proteins co-localized within the nucleus.

AA Sequence

MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV      1 - 70
CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKA     71 - 140
TSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVA    141 - 210
DKLLKRASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAA    211 - 280
EVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF    281 - 350
NLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP    351 - 420
//

Publication (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22246180 2012 Cwc2 and its human homologue RBM22 promote an active conformation of the spliceosome catalytic centre.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21122810 2011 Stress induced subcellular distribution of ALG-2, RBM22 and hSlu7.
More...