Property Summary

NCBI Gene PubMed Count 23
PubMed Score 7.65
PubTator Score 3.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.400 6.5e-03
group 3 medulloblastoma 1.100 6.3e-03
malignant mesothelioma 1.800 1.1e-07
Multiple myeloma 1.848 4.3e-04
oligodendroglioma 1.100 1.8e-02
osteosarcoma -1.900 2.5e-05
ovarian cancer -1.300 8.4e-06
subependymal giant cell astrocytoma -1.135 4.7e-02

Gene RIF (2)

AA Sequence

MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEV      1 - 70
CQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKA     71 - 140
TSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVA    141 - 210
DKLLKRASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAA    211 - 280
EVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF    281 - 350
NLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP    351 - 420
//

Text Mined References (32)

PMID Year Title