Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.96
PubTator Score 6.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8520 4.0e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Lymphoid leukemia 160 0.0 1.4

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.900 4.0e-06

Synonym

Accession Q9NVR2 Q6IA93 Q7L538 Q7L8C8 Q9H3W8 Int10
Symbols INT10
C8orf35

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Protein-protein Interaction (4)

Gene RIF (1)

AA Sequence

MSAQGDCEFLVQRARELVPQDLWAAKAWLITARSLYPADFNIQYEMYTIERNAERTATAGRLLYDMFVNF      1 - 70
PDQPVVWREISIITSALRNDSQDKQTQFLRSLFETLPGRVQCEMLLKVTEQCFNTLERSEMLLLLLRRFP     71 - 140
ETVVQHGVGLGEALLEAETIEEQESPVNCFRKLFVCDVLPLIINNHDVRLPANLLYKYLNKAAEFYINYV    141 - 210
TRSTQIENQHQGAQDTSDLMSPSKRSSQKYIIEGLTEKSSQIVDPWERLFKILNVVGMRCEWQMDKGRRS    211 - 280
YGDILHRMKDLCRYMNNFDSEAHAKYKNQVVYSTMLVFFKNAFQYVNSIQPSLFQGPNAPSQVPLVLLED    281 - 350
VSNVYGDVEIDRNKHIHKKRKLAEGREKTMSSDDEDCSAKGRNRHIVVNKAELANSTEVLESFKLARESW    351 - 420
ELLYSLEFLDKEFTRICLAWKTDTWLWLRIFLTDMIIYQGQYKKAIASLHHLAALQGSISQPQITGQGTL    421 - 490
EHQRALIQLATCHFALGEYRMTCEKVLDLMCYMVLPIQDGGKSQEEPSKVKPKFRKGSDLKLLPCTSKAI    491 - 560
MPYCLHLMLACFKLRAFTDNRDDMALGHVIVLLQQEWPRGENLFLKAVNKICQQGNFQYENFFNYVTNID    561 - 630
MLEEFAYLRTQEGGKIHLELLPNQGMLIKHHTVTRGITKGVKEDFRLAMERQVSRCGENLMVVLHRFCIN    631 - 700
EKILLLQTLT                                                                701 - 710
//

Text Mined References (18)

PMID Year Title