Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.28289665542528E-7
tuberculosis 1563 4.37891077244127E-5
psoriasis 6685 1.34014805110391E-4
posterior fossa group B ependymoma 1530 1.65029940427006E-4
lung cancer 4473 0.00143774259468481
chronic rhinosinusitis 512 0.0117552074581857
adrenocortical carcinoma 1427 0.0157267152749186
Breast cancer 3099 0.0249939385772151

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -2.200 0.000
osteosarcoma -2.052 0.000
adrenocortical carcinoma 1.547 0.016
tuberculosis -1.400 0.000
lung cancer 1.100 0.001
Breast cancer 2.600 0.025
posterior fossa group B ependymoma 1.200 0.000
chronic rhinosinusitis -1.486 0.012

Synonym

Accession Q9NVP4 B7ZLZ4 Q4F7X1 Q5QPD9 Q5QPE0 Q68DN8 Q6ZMX9 Q96NF0 Q9H1E0 Q9H442
Symbols ANKRD64
C20orf12
C20orf84
dJ568F9.2
bA189K21.1
bA189K21.8

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MTAGSVCVPQIIPLRVPQPGKANHEIDNNTLLEMKSDTPDVNIYYTLDGSKPEFLKRIGYGENNTFKYIK      1 - 70
PITLPDGKIQVKAIAVSKDCRQSGIVTKVFHVDYEPPNIVSPEDNVENVLKDSSRQEFKNGFVGSKLKKK     71 - 140
YKNSENQRSWNVNLRKFPESPLEIPAYGGGSGSRPPTRQSQSPGFAHVSGQKCLTSTEIMRIQRETDFLK    141 - 210
CAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQP    211 - 280
QASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQESMCSGDKAPPPPTQKGGTISCYRCGRWNLWEA    281 - 350
SFCGWCGAMLGIPAGCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAEEPRPFSESLNIPL    351 - 420
PRSDVGTKRDIGTQTVGLFYPSGKLLAKKEQELASQKQRQEKMSDHKPLLTAISPGRGYWRRQLDHISAH    421 - 490
LRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVNFSDHLLSSAAEGDG    491 - 560
GLCGSRSSWVSDYSQSTSDTIEKIKRIKNFKTKTFQEKKEQLIPENRLLLKEVGPTGEGRVSVIEQLLDE    561 - 630
GADPNCCDEDNRPVITVAVMNKHHEAIPVLVQRGADIDQQWGPLRNTALHEATLLGLAGRESTATLLGCN    631 - 700
ASIQKKNAGGQTAYDLALNTGDDLVTSLFAAKFGQGLEDQLAQTRSLSLDDC                      701 - 752
//

Text Mined References (10)

PMID Year Title
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10431175 1999 The ankyrin repeat: a diversity of interactions on a common structural framework.