Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.29
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma 1.547 1.6e-02
Breast cancer 2.600 2.5e-02
chronic rhinosinusitis -1.486 1.2e-02
lung cancer 1.100 1.4e-03
osteosarcoma -2.052 1.3e-07
posterior fossa group B ependymoma 1.200 1.7e-04
psoriasis -2.200 1.3e-04
tuberculosis -1.400 4.4e-05

Synonym

Accession Q9NVP4 B7ZLZ4 Q4F7X1 Q5QPD9 Q5QPE0 Q68DN8 Q6ZMX9 Q96NF0 Q9H1E0 Q9H442
Symbols ANKRD64
C20orf12
C20orf84
dJ568F9.2
bA189K21.1
bA189K21.8

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MTAGSVCVPQIIPLRVPQPGKANHEIDNNTLLEMKSDTPDVNIYYTLDGSKPEFLKRIGYGENNTFKYIK      1 - 70
PITLPDGKIQVKAIAVSKDCRQSGIVTKVFHVDYEPPNIVSPEDNVENVLKDSSRQEFKNGFVGSKLKKK     71 - 140
YKNSENQRSWNVNLRKFPESPLEIPAYGGGSGSRPPTRQSQSPGFAHVSGQKCLTSTEIMRIQRETDFLK    141 - 210
CAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQP    211 - 280
QASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQESMCSGDKAPPPPTQKGGTISCYRCGRWNLWEA    281 - 350
SFCGWCGAMLGIPAGCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAEEPRPFSESLNIPL    351 - 420
PRSDVGTKRDIGTQTVGLFYPSGKLLAKKEQELASQKQRQEKMSDHKPLLTAISPGRGYWRRQLDHISAH    421 - 490
LRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVNFSDHLLSSAAEGDG    491 - 560
GLCGSRSSWVSDYSQSTSDTIEKIKRIKNFKTKTFQEKKEQLIPENRLLLKEVGPTGEGRVSVIEQLLDE    561 - 630
GADPNCCDEDNRPVITVAVMNKHHEAIPVLVQRGADIDQQWGPLRNTALHEATLLGLAGRESTATLLGCN    631 - 700
ASIQKKNAGGQTAYDLALNTGDDLVTSLFAAKFGQGLEDQLAQTRSLSLDDC                      701 - 752
//

Text Mined References (11)

PMID Year Title