Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.48
PubTator Score 4.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.440 7.7e-07
dermatomyositis 1.200 3.6e-04
glioblastoma 1.100 2.1e-02
group 4 medulloblastoma 1.100 4.3e-03
medulloblastoma, large-cell 1.500 4.1e-04
osteosarcoma 1.247 9.6e-05
ovarian cancer 1.100 1.4e-03
primitive neuroectodermal tumor 1.100 5.1e-05
psoriasis -1.800 7.5e-05

Gene RIF (5)

AA Sequence

MSHLPMKLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQN      1 - 70
GGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEES     71 - 140
AETTKETENNVEKPDNDEDESEVPSLPLGLTGAFEDTSFASLCNLVNENTLKAIKEMGFTNMTEIQHKSI    141 - 210
RPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRFMPRNGTGVLILSPTRELAMQTFGVLKELMTHHVH    211 - 280
TYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQI    281 - 350
IKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYVGVDDDKANATVDGLEQGYVVCPSEKRFLLLFTFL    351 - 420
KKNRKKKLMVFFSSCMSVKYHYELLNYIDLPVLAIHGKQKQNKRTTTFFQFCNADSGTLLCTDVAARGLD    421 - 490
IPEVDWIVQYDPPDDPKEYIHRVGRTARGLNGRGHALLILRPEELGFLRYLKQSKVPLSEFDFSWSKISD    491 - 560
IQSQLEKLIEKNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSFGFKVPPFVDLNVNSNEG    561 - 630
KQKKRGGGGGFGYQKTKKVEKSKIFKHISKKSSDSRQFSH                                  631 - 670
//

Text Mined References (19)

PMID Year Title