Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
Funding $185,618
PubMed Score 4.48
PubTator Score 4.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.800 0.000
osteosarcoma 1.362 0.000
sonic hedgehog group medulloblastoma 1.200 0.004
glioblastoma 1.100 0.021
medulloblastoma, large-cell 1.500 0.000
primitive neuroectodermal tumor 1.100 0.000
acute quadriplegic myopathy 1.440 0.000
ovarian cancer 1.700 0.001
dermatomyositis 1.200 0.000

Synonym

Accession Q9NVP1 Q6GTZ9 Q6IAU4 Q92732 Q9BQB7
Symbols MrDb

Gene

PDB

3LY5  

Gene RIF (5)

PMID Text
25284587 Data show that odulation of RNA helicase DDX18 directly affects growth of tamoxifen-resistant cells, suggesting that it may be a critical downstream effector of the estrogen receptors (ERs) and high mobility group box 2 (HMGB2) complex.
22944692 Positional proteomics analysis identifies the cleavage of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 (DDX18) at amino acid residues 35-36 by the HIV-1 protease
21653321 We identified 4 nonsynonymous sequence variants of DDX18 in acute myeloid leukemia patient samples
20689807 Observational study of gene-disease association. (HuGE Navigator)
18351129 findings suggest that MrDb is important for cell proliferation and that its inhibition could prevent tumor cell proliferation.

AA Sequence

MSHLPMKLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQN      1 - 70
GGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEES     71 - 140
AETTKETENNVEKPDNDEDESEVPSLPLGLTGAFEDTSFASLCNLVNENTLKAIKEMGFTNMTEIQHKSI    141 - 210
RPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRFMPRNGTGVLILSPTRELAMQTFGVLKELMTHHVH    211 - 280
TYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQI    281 - 350
IKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYVGVDDDKANATVDGLEQGYVVCPSEKRFLLLFTFL    351 - 420
KKNRKKKLMVFFSSCMSVKYHYELLNYIDLPVLAIHGKQKQNKRTTTFFQFCNADSGTLLCTDVAARGLD    421 - 490
IPEVDWIVQYDPPDDPKEYIHRVGRTARGLNGRGHALLILRPEELGFLRYLKQSKVPLSEFDFSWSKISD    491 - 560
IQSQLEKLIEKNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSFGFKVPPFVDLNVNSNEG    561 - 630
KQKKRGGGGGFGYQKTKKVEKSKIFKHISKKSSDSRQFSH                                  631 - 670
//

Text Mined References (19)

PMID Year Title
25284587 2015 Genomic interaction between ER and HMGB2 identifies DDX18 as a novel driver of endocrine resistance in breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21653321 2011 Ddx18 is essential for cell-cycle progression in zebrafish hematopoietic cells and is mutated in human AML.
21269460 2011 Initial characterization of the human central proteome.
20941364 2010 Comparative structural analysis of human DEAD-box RNA helicases.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
19946888 2010 Defining the membrane proteome of NK cells.
More...