Property Summary

NCBI Gene PubMed Count 10
PubMed Score 43.42
PubTator Score 10.41

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count Z-score Confidence
Olfactory neuroblastoma 5 3.472 1.7



Accession Q9NVN3 A2RTZ0 Q4G103 Q6ZRN4 Q86WD3
Symbols RIC8


  Ortholog (13)

Pathway (1)

Gene RIF (3)

20133939 Ric-8B plays a critical and specific role in the control of G alpha(s) protein levels by modulating G alpha(s) ubiquitination and positively regulates G(s) signaling
19460752 Knockdown of resistance to inhibitors of cholinesterase 8 homolog B (C. elegans, RIC8B) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
12652642 We identified a protein member of the synembryn family as one of the interacting proteins in human brain. Gqalpha also interacts with synembryn. Synembryn translocates to the plasma membrane in response to carbachol and isoproterenol.

AA Sequence

MGLKPDGTITPLEEALNQYSVIEETSSDTD                                            491 - 520

Text Mined References (12)

PMID Year Title
24133439 2013 Genome-wide association study of autistic-like traits in a general population study of young adults.
20133939 2010 Ric-8B stabilizes the alpha subunit of stimulatory G protein by inhibiting its ubiquitination.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12652642 2003 Human brain synembryn interacts with Gsalpha and Gqalpha and is translocated to the plasma membrane in response to isoproterenol and carbachol.
12509430 2003 Mammalian Ric-8A (synembryn) is a heterotrimeric Galpha protein guanine nucleotide exchange factor.