Property Summary

NCBI Gene PubMed Count 15
Grant Count 10
R01 Count 10
Funding $1,883,031.5
PubMed Score 14.35
PubTator Score 5.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.608 0.004
psoriasis 1.600 0.000
osteosarcoma 1.522 0.003
glioblastoma 1.300 0.013
medulloblastoma, large-cell 1.200 0.004
non-small cell lung cancer 1.270 0.000
lung cancer 2.400 0.000
colon cancer 1.100 0.000
sonic hedgehog group medulloblastoma 1.300 0.000
nasopharyngeal carcinoma 1.200 0.000
ovarian cancer 1.700 0.006
dermatomyositis 1.200 0.006

Gene RIF (2)

PMID Text
23904267 ASUN is identified as a functional component of Integrator (INT), a multisubunit complex required for 3'-end processing of small nuclear RNAs.
23097494 Data suggest that ASUN promotes perinuclear enrichment of dynein at G2/M that facilitates BICD2- and CENP-F-mediated anchoring of dynein to nuclear pore complexes.

AA Sequence

MKIFSESHKTVFVVDHCPYMAESCRQHVEFDMLVKNRTQGIIPLAPISKSLWTCSVESSMEYCRIMYDIF      1 - 70
PFKKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECCSILHGLVAAVETLCKITEYQ     71 - 140
HEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQETIHEHNKLAANSDHLMQIQKCELVLIHTY    141 - 210
PVGEDSLVSDRSKKELSPVLTSEVHSVRAGRHLATKLNILVQQHFDLASTTITNIPMKEEQHANTSANYD    211 - 280
VELLHHKDAHVDFLKSGDSHLGGGSREGSFKETITLKWCTPRTNNIELHYCTGAYRISPVDVNSRPSSCL    281 - 350
TNFLLNGRSVLLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTDYRITDFGE    351 - 420
FMRENRLTPFLDPRYKIDGSLEVPLERAKDQLEKHTRYWPMIISQTTIFNMQAVVPLASVIVKESLTEED    421 - 490
VLNCQKTIYNLVDMERKNDPLPISTVGTRGKGPKRDEQYRIMWNELETLVRAHINNSEKHQRVLECLMAC    491 - 560
RSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEKSWQDSERLKGILERGKEELAEAEIIKDSPDSPEPP    561 - 630
NKKPLVEMDETPQVEKSKGPVSLLSLWSNRINTANSRKHQEFAGRLNSVNNRAELYQHLKEENGMETTEN    631 - 700
GKASRQ                                                                    701 - 706
//

Text Mined References (24)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23904267 2013 Nuclear-localized Asunder regulates cytoplasmic dynein localization via its role in the integrator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23097494 2012 Human Asunder promotes dynein recruitment and centrosomal tethering to the nucleus at mitotic entry.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19357193 2009 Asunder is a critical regulator of dynein-dynactin localization during Drosophila spermatogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...