Property Summary

NCBI Gene PubMed Count 15
PubMed Score 15.42
PubTator Score 5.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Chloracne 32 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Granulosa cell tumor 6 4.624 2.3
Giant cell tumor 5 3.772 1.9

Expression

  Differential Expression (12)

Disease log2 FC p
colon cancer 1.100 4.9e-04
dermatomyositis 1.200 6.1e-03
glioblastoma 1.300 1.3e-02
group 3 medulloblastoma 1.200 3.9e-03
lung cancer 2.400 9.5e-05
medulloblastoma, large-cell 1.200 3.9e-03
Multiple myeloma 1.608 3.6e-03
nasopharyngeal carcinoma 1.200 3.0e-04
non-small cell lung cancer 1.270 1.9e-21
osteosarcoma 1.522 2.8e-03
ovarian cancer 1.700 6.1e-03
psoriasis 1.600 2.3e-04

Gene RIF (2)

AA Sequence

MKIFSESHKTVFVVDHCPYMAESCRQHVEFDMLVKNRTQGIIPLAPISKSLWTCSVESSMEYCRIMYDIF      1 - 70
PFKKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECCSILHGLVAAVETLCKITEYQ     71 - 140
HEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQETIHEHNKLAANSDHLMQIQKCELVLIHTY    141 - 210
PVGEDSLVSDRSKKELSPVLTSEVHSVRAGRHLATKLNILVQQHFDLASTTITNIPMKEEQHANTSANYD    211 - 280
VELLHHKDAHVDFLKSGDSHLGGGSREGSFKETITLKWCTPRTNNIELHYCTGAYRISPVDVNSRPSSCL    281 - 350
TNFLLNGRSVLLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTDYRITDFGE    351 - 420
FMRENRLTPFLDPRYKIDGSLEVPLERAKDQLEKHTRYWPMIISQTTIFNMQAVVPLASVIVKESLTEED    421 - 490
VLNCQKTIYNLVDMERKNDPLPISTVGTRGKGPKRDEQYRIMWNELETLVRAHINNSEKHQRVLECLMAC    491 - 560
RSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEKSWQDSERLKGILERGKEELAEAEIIKDSPDSPEPP    561 - 630
NKKPLVEMDETPQVEKSKGPVSLLSLWSNRINTANSRKHQEFAGRLNSVNNRAELYQHLKEENGMETTEN    631 - 700
GKASRQ                                                                    701 - 706
//

Text Mined References (25)

PMID Year Title