Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.72
PubTator Score 0.57

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.100 4.4e-02
group 3 medulloblastoma 1.200 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.100 3.2e-03

Gene RIF (3)

AA Sequence

MAVTKELLQMDLYALLGIEEKAADKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQALEVLTDAAARA      1 - 70
AYDKVRKAKKQAAERTQKLDEKRKKVKLDLEARERQAQAQESEEEEESRSTRTLEQEIERLREEGSRQLE     71 - 140
EQQRLIREQIRQERDQRLRGKAENTEGQGTPKLKLKWKCKKEDESKGGYSKDVLLRLLQKYGEVLNLVLS    141 - 210
SKKPGTAVVEFATVKAAELAVQNEVGLVDNPLKISWLEGQPQDAVGRSHSGLSKGSVLSERDYESLVMMR    211 - 280
MRQAAERQQLIARMQQEDQEGPPT                                                  281 - 304
//

Text Mined References (15)

PMID Year Title