Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAPEENAGSELLLQSFKRRFLAARALRSFRWQSLEAKLRDSSDSELLRDILQKHEAVHTEPLDELYEVLV      1 - 70
ETLMAKESTQGHRSYLLTCCIAQKPSCRWSGSCGGWLPAGSTSGLLNSTWPLPSATQRCASCSPPSYAGL     71 - 140
GSDGKRKLIMTRNCFPTESTWRWQS                                                 141 - 165
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.