Property Summary

NCBI Gene PubMed Count 22
PubMed Score 5.60
PubTator Score 4.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
group 4 medulloblastoma 1855 2.7e-08
ovarian cancer 8519 1.4e-05
osteosarcoma 7950 1.0e-02
invasive ductal carcinoma 2950 1.9e-02
Breast cancer 3577 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Chromosomal disease 2 3.495 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 2.200 4.2e-02
group 4 medulloblastoma 2.100 2.7e-08
invasive ductal carcinoma 1.200 1.9e-02
osteosarcoma 1.406 1.0e-02
ovarian cancer -1.400 1.4e-05

Gene RIF (4)

AA Sequence

MAAAAEERMAEEGGGGQGDGGSSLASGSTQRQPPPPAPQHPQPGSQALPAPALAPDQLPQNNTLVALPIV      1 - 70
AIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQVKAQLPRRESERRNHSLARHA     71 - 140
DILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYRVLRYVNSTRAPQRAHEVLQELRDISSMAMEY    141 - 210
FDEKIVPILKRKLPGSDVSGRLMGSPPVPGPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRR    211 - 280
EISELRTKVQEQQKQLQDQDQKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSGSGQNEESPRKRKK    281 - 350
ATEAIDSLRKSKRLRNRK                                                        351 - 368
//

Text Mined References (29)

PMID Year Title