Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.27
PubTator Score 0.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

AA Sequence

MQKGKGRTSRIRRRKLCGSSESRGVNESHKSEFIELRKWLKARKFQDSNLAPACFPGTGRGLMSQTSLQE      1 - 70
GQMIISLPESCLLTTDTVIRSYLGAYITKWKPPPSPLLALCTFLVSEKHAGHRSLWKPYLEILPKAYTCP     71 - 140
VCLEPEVVNLLPKSLKAKAEEQRAHVQEFFASSRDFFSSLQPLFAEAVDSIFSYSALLWAWCTVNTRAVY    141 - 210
LRPRQRECLSAEPDTCALAPYLDLLNHSPHVQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRL    211 - 280
FLEYGFVSVHNPHACVYVSREILVKYLPSTDKQMDKKISILKDHGYIENLTFGWDGPSWRLLTALKLLCL    281 - 350
EAEKFTCWKKVLLGEVISDTNEKTSLDIAQKICYYFIEETNAVLQKVSHMKDEKEALINQLTLVESLWTE    351 - 420
ELKILRASAETLHSLQTAFT                                                      421 - 440
//

Text Mined References (9)

PMID Year Title