Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.03
PubTator Score 3.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
group 3 medulloblastoma 4104 1.0e-04
osteosarcoma 7950 2.1e-03
astrocytoma 1146 3.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Opisthorchiasis 15 4.185 2.1

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma 1.500 3.5e-03
group 3 medulloblastoma 1.400 1.0e-04
osteosarcoma -1.241 2.1e-03

Gene RIF (1)

AA Sequence

MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDGNAFLDKELKE      1 - 70
CSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEPTVQIGRLLMEEL     71 - 140
VNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKIELFGAVQ    141 - 210
VTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGE    211 - 280
FCSNLALTVRNGGNVLVPCYPSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHN    281 - 350
KQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTV    351 - 420
IFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMI    421 - 490
DCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPA    491 - 560
QPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEE    561 - 630
DSTHIICDNDEMLRVRLRDLVLKFLQKF                                              631 - 658
//

Text Mined References (11)

PMID Year Title