Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.31
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.082 4.9e-02
group 4 medulloblastoma 1.200 6.7e-03
hereditary spastic paraplegia -1.016 2.0e-02
intraductal papillary-mucinous neoplasm ... 1.600 1.3e-02
lung cancer 1.400 4.5e-03
lung carcinoma 1.100 1.3e-21
Multiple myeloma 1.197 8.8e-04
ovarian cancer -2.400 3.7e-07
progressive supranuclear palsy -1.100 2.9e-02
psoriasis -1.200 2.6e-03

Synonym

Accession Q9NV79 E1P5H3 Q8IW60 Q9H4K2
Symbols C20orf36

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGGAVSAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHGNIHLSAPCIYS      1 - 70
EVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLDFFIRTSDSFDKFDF     71 - 140
CEPSFVTGNCLEISPDCSQYDRVYCGAGVQKEHEEYMKNLLKVGGILVMPLEEKLTKITRTGPSAWETKK    141 - 210
ILAVSFAPLIQPCHSESGKSRLVQLPPVAVRSLQDLARIAIRGTIKKIIHQETVSKNGNGLKNTPRFKRR    211 - 280
RVRRRRMETIVFLDKEVFASRISNPSDDNSCEDLEEERREEEEKTPPETKPDPPVNFLRQKVLSLPLPDP    281 - 350
LKYYLLYYREK                                                               351 - 361
//

Text Mined References (6)

PMID Year Title