Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.09
PubTator Score 3.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 2.200 8.6e-03
atypical teratoid / rhabdoid tumor 1.200 2.3e-07
glioblastoma 1.100 1.8e-06
group 3 medulloblastoma 1.100 3.3e-04
malignant mesothelioma 1.200 2.3e-06
non primary Sjogren syndrome sicca 1.100 2.2e-02
ovarian cancer 1.600 1.4e-05
primitive neuroectodermal tumor 1.300 7.4e-04
tuberculosis -1.600 8.6e-07

Gene RIF (6)

AA Sequence

MPGGRRGPSRQQLSRSALPSLQTLVGGGCGNGTGLRNRNGSAIGLPVPPITALITPGPVRHCQIPDLPVD      1 - 70
GSLLFEFLFFIYLLVALFIQYINIYKTVWWYPYNHPASCTSLNFHLIDYHLAAFITVMLARRLVWALISE     71 - 140
ATKAGAASMIHYMVLISARLVLLTLCGWVLCWTLVNLFRSHSVLNLLFLGYPFGVYVPLCCFHQDSRAHL    141 - 210
LLTDYNYVVQHEAVEESASTVGGLAKSKDFLSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKAD    211 - 280
FNHRIKEVLFNSLFSAYYVAFLPLCFVKSTQYYDMRWSCEHLIMVWINAFVMLTTQLLPSKYCDLLHKSA    281 - 350
AHLGKWQKLEHGSYSNAPQHIWSENTIWPQGVLVRHSRCLYRAMGPYNVAVPSDVSHARFYFLFHRPLRL    351 - 420
LNLLILIEGSVVFYQLYSLLRSEKWNHTLSMALILFCNYYVLFKLLRDRIVLGRAYSYPLNSYELKAN      421 - 488
//

Text Mined References (15)

PMID Year Title