Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.84
PubTator Score 6.50

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
24565846 Overexpression of TCP10L in hepatocellular carcinoma cells suppressed colony formation, inhibited cell cycle progression through G0/G1 phase, and attenuated cell growth in vivo.
15910542 The specific expression pattern of TCP10L and interaction with DAPK-3 implies that TCP10L might play crucially important roles in spermatogenesis through its interaction with DAPK-3.
15469726 Data suggest that the biological function of the interaction between T-complex protein 10-like and MAD4 may be to maintain the differentiation state in liver cells.
14586771 The result revealed that TCP10L expressed specifically in the human liver and testis

AA Sequence

MERPLIWHLPGLFPRPQFCPCSCGCFLHCGSHGEETRVPLVESGKNSIFTSLPANDHSSFTTSAGTYLGK      1 - 70
ETGPMWWPSLRCGRASGVALMHSTAQACGHHSPWAAWHLDSFPSLAEVCVALQGRI                   71 - 126
//

Text Mined References (14)

PMID Year Title
24565846 2014 TCP10L acts as a tumor suppressor by inhibiting cell proliferation in hepatocellular carcinoma.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17377852 2008 Identification of TCP10L as primate-specific gene derived via segmental duplication and homodimerization of TCP10L through the leucine zipper motif.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15910542 2005 TCP10L is expressed specifically in spermatogenic cells and binds to death associated protein kinase-3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469726 2004 Human liver specific transcriptional factor TCP10L binds to MAD4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14586771 2003 Identification of a novel liver-specific expressed gene, TCP10L, encoding a human leucine zipper protein with transcription inhibition activity.
More...