Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.93
PubTator Score 3.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 2.69300775335525E-20
astrocytoma 1493 4.14701446448469E-20
non-small cell lung cancer 2798 1.90145534590349E-18
oligodendroglioma 2849 2.50705665641736E-13
ependymoma 2514 1.96543014803042E-11
juvenile dermatomyositis 1189 9.94382583280952E-11
glioblastoma 5572 8.61324807887892E-10
atypical teratoid/rhabdoid tumor 1095 2.32992957399805E-9
pediatric high grade glioma 2712 7.14608096312939E-9
acute quadriplegic myopathy 1157 4.36633535321793E-8
medulloblastoma, large-cell 6234 2.05668092170798E-6
lung cancer 4473 2.63809095181322E-6
Breast cancer 3099 1.17831765593797E-5
group 3 medulloblastoma 2254 1.20525736499666E-5
pilocytic astrocytoma 3086 1.30883921714742E-5
primitive neuroectodermal tumor 3031 3.94492623378918E-5
ovarian cancer 8492 4.40415978502846E-5
osteosarcoma 7933 0.00318885906784121
invasive ductal carcinoma 2950 0.00325582995708975
ductal carcinoma in situ 1745 0.00372828478294005
gastric cancer 436 0.00415786927639374
non primary Sjogren syndrome sicca 840 0.0243216283486384

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer 1.100 0.004
astrocytoma 1.300 0.000
glioblastoma 1.600 0.000
oligodendroglioma 1.300 0.000
osteosarcoma 1.688 0.003
ependymoma 1.200 0.000
group 3 medulloblastoma 1.800 0.000
atypical teratoid/rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 1.300 0.000
juvenile dermatomyositis 1.236 0.000
acute quadriplegic myopathy 1.695 0.000
non-small cell lung cancer 1.387 0.000
lung cancer 2.700 0.000
pediatric high grade glioma 1.500 0.000
pilocytic astrocytoma 1.300 0.000
non primary Sjogren syndrome sicca -1.100 0.024
Breast cancer 1.400 0.000
breast carcinoma 1.300 0.000
ductal carcinoma in situ 1.200 0.004
invasive ductal carcinoma 1.800 0.003
ovarian cancer 2.900 0.000

Synonym

Accession Q9NV06 Q3MII9 Q8NCH8 Q8TC51 Q96JY7 Q9NZX3
Symbols GM83
WDSOF1
HSPC064

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (2)

PMID Text
20601284 This study suggests that non-synonymous WDSOF1 polymorphisms play a role in the genetic susceptibility to osteoporosis.
20601284 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKVKMLSRNPDNYVRETKLDLQRVPRNYDPALHPFEVPREYIRALNATKLERVFAKPFLASLDGHRDGVN      1 - 70
CLAKHPEKLATVLSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDG     71 - 140
PGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETF    141 - 210
LLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALDTPVMVHMD    211 - 280
HVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIR    281 - 350
LWKANASEKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVN    351 - 420
RIKHSKPGSVPLVSEKKKHVVAVVK                                                 421 - 445
//

Text Mined References (12)

PMID Year Title
24754225 2014 Dynamics of WD-repeat containing proteins in SSU processome components.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20601284 2010 Identification of non-synonymous polymorphisms in the WDSOF1 gene as novel susceptibility markers for low bone mineral density in Japanese postmenopausal women.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
16949367 2006 A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...