Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.77
PubTator Score 3.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy 1.695 4.4e-08
adult high grade glioma 1.200 2.1e-03
astrocytoma 1.200 2.1e-18
Astrocytoma, Pilocytic 1.100 1.4e-06
atypical teratoid / rhabdoid tumor 1.300 1.9e-06
Breast cancer 1.400 1.2e-05
breast carcinoma 1.200 8.8e-22
ductal carcinoma in situ 1.200 3.7e-03
ependymoma 1.200 2.0e-11
gastric cancer 1.100 4.2e-03
glioblastoma 1.600 8.6e-10
group 3 medulloblastoma 1.800 1.2e-05
invasive ductal carcinoma 1.500 1.8e-03
juvenile dermatomyositis 1.236 9.9e-11
lung cancer 2.700 2.6e-06
medulloblastoma, large-cell 1.800 2.1e-06
non primary Sjogren syndrome sicca -1.100 2.4e-02
non-small cell lung cancer 1.387 1.9e-18
oligodendroglioma 1.200 7.6e-14
osteosarcoma 1.390 4.1e-03
ovarian cancer 2.900 4.4e-05
primitive neuroectodermal tumor 1.300 3.9e-05

Gene RIF (3)

AA Sequence

MKVKMLSRNPDNYVRETKLDLQRVPRNYDPALHPFEVPREYIRALNATKLERVFAKPFLASLDGHRDGVN      1 - 70
CLAKHPEKLATVLSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDG     71 - 140
PGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETF    141 - 210
LLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALDTPVMVHMD    211 - 280
HVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIR    281 - 350
LWKANASEKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVN    351 - 420
RIKHSKPGSVPLVSEKKKHVVAVVK                                                 421 - 445
//

Text Mined References (14)

PMID Year Title