Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.57
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
tuberculosis 2010 1.8e-06
ovarian cancer 8520 5.7e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 0.9

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.300 5.7e-06
tuberculosis -1.200 1.8e-06

Gene RIF (3)

AA Sequence

MAEGEDVPPLPTSSGDGWEKDLEEALEAGGCDLETLRNIIQGRPLPADLRAKVWKIALNVAGKGDSLASW      1 - 70
DGILDLPEQNTIHKDCLQFIDQLSVPEEKAAELLLDIESVITFYCKSRNIKYSTSLSWIHLLKPLVHLQL     71 - 140
PRSDLYNCFYAIMNKYIPRDCSQKGRPFHLFRLLIQYHEPELCSYLDTKKITPDSYALNWLGSLFACYCS    141 - 210
TEVTQAIWDGYLQQADPFFIYFLMLIILVNAKEVILTQESDSKEEVIKFLENTPSSLNIEDIEDLFSLAQ    211 - 280
YYCSKTPASFRKDNHHLFGSTLLGIKDDDADLSQALCLAISVSEILQANQLQGEGVRFFVVDCRPAEQYN    281 - 350
AGHLSTAFHLDSDLMLQNPSEFAQSVKSLLEAQKQSIESGSIAGGEHLCFMGSGREEEDMYMNMVLAHFL    351 - 420
QKNKEYVSIASGGFMALQQHLADINVDGPENGYGHWIASTSGSRSSINSVDGESPNGSSDRGMKSLVNKM    421 - 490
TVALKTKSVNVREKVISFIENTSTPVDRMSFNLPWPDRSCTERHVSSSDRVGKPYRGVKPVFSIGDEEEY    491 - 560
DTDEIDSSSMSDDDRKEVVNIQTWINKPDVKHHFPCKEVKESGHMFPSHLLVTATHMYCLREIVSRKGLA    561 - 630
YIQSRQALNSVVKITSKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATKAIKQQIMKVLDALES     631 - 699
//

Text Mined References (21)

PMID Year Title