Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.99
PubTator Score 17.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.4e-03

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.100 1.4e-03

AA Sequence

MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLV      1 - 70
DNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSG     71 - 140
TGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISE    141 - 210
QIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSV    211 - 280
WKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAA    281 - 350
ELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNE    351 - 420
TYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN                421 - 478
//

Text Mined References (16)

PMID Year Title