Property Summary

NCBI Gene PubMed Count 17
Grant Count 1
Funding $32,177.62
PubMed Score 20.25
PubTator Score 4.39

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
25284053 Three proteins-matrix metalloproteinase-9, neutrophil elastase, and FAM49B-were significantly lower in abundance in samples from women with endometriosis.
21555518 FAM49B is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.

AA Sequence

MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHP      1 - 70
ADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQHLEREQALAKQFAEILHFTL     71 - 140
RFDELKMTNPAIQNDFSYYRRTLSRMRINNVPAEGENEVNNELANRMSLFYAEATPMLKTLSDATTKFVS    141 - 210
ENKNLPIENTTDCLSTMASVCRVMLETPEYRSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKID    211 - 280
MKGCIKVLKDQPPNSVEGLLNALRYTTKHLNDETTSKQIKSMLQ                              281 - 324
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25284053 2015 Urine, peritoneal fluid and omental fat proteomes of reproductive age women: Endometriosis-related changes and associations with endocrine disrupting chemicals.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...