Property Summary

NCBI Gene PubMed Count 19
PubMed Score 22.22
PubTator Score 4.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -2.500 2.7e-04
astrocytic glioma -1.500 1.3e-02
Astrocytoma, Pilocytic -1.600 1.1e-03
atypical teratoid / rhabdoid tumor -3.000 1.8e-08
Breast cancer 1.500 2.4e-07
cutaneous lupus erythematosus 1.200 3.9e-02
ependymoma -2.200 7.4e-03
glioblastoma -2.200 8.5e-07
group 4 medulloblastoma -1.200 3.8e-02
intraductal papillary-mucinous carcinoma... 1.400 1.1e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.3e-02
malignant mesothelioma 1.200 1.8e-04
medulloblastoma, large-cell -2.200 8.5e-07
oligodendroglioma -1.400 3.4e-02
osteosarcoma 1.575 1.5e-03
Pick disease -1.300 1.5e-02
primary Sjogren syndrome 1.200 1.0e-02
primitive neuroectodermal tumor -1.700 5.1e-03
subependymal giant cell astrocytoma -2.055 3.3e-03

Synonym

Accession Q9NUQ9 Q96AZ5 Q9NW21 Q9NZE7
Symbols L1
BM-009

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (2)

AA Sequence

MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHP      1 - 70
ADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQHLEREQALAKQFAEILHFTL     71 - 140
RFDELKMTNPAIQNDFSYYRRTLSRMRINNVPAEGENEVNNELANRMSLFYAEATPMLKTLSDATTKFVS    141 - 210
ENKNLPIENTTDCLSTMASVCRVMLETPEYRSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKID    211 - 280
MKGCIKVLKDQPPNSVEGLLNALRYTTKHLNDETTSKQIKSMLQ                              281 - 324
//

Text Mined References (22)

PMID Year Title