Property Summary

NCBI Gene PubMed Count 11
PubMed Score 54.78
PubTator Score 37.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Scarlet fever 8 3.987 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.1e-02
invasive ductal carcinoma -1.028 1.6e-02
juvenile dermatomyositis 1.003 1.6e-13
medulloblastoma, large-cell 1.600 4.1e-04
ovarian cancer -2.300 1.6e-08
psoriasis -1.600 2.5e-04

Gene RIF (3)

AA Sequence

MATRVEEAARGRGGGAEEATEAGRGGRRRSPRQKFEIGTMEEAGICGLGVKADMLCNSQSNDILQHQGSN      1 - 70
CGGTSNKHSLEEDEGSDFITENRNLVSPAYCTQESREEIPGGEARTDPPDGQQDSECNRNKEKTLGKEVL     71 - 140
LLMQALNTLSTPEEKLAALCKKYADLLEESRSVQKQMKILQKKQAQIVKEKVHLQSEHSKAILARSKLES    141 - 210
LCRELQRHNKTLKEENMQQAREEEERRKEATAHFQITLNEIQAQLEQHDIHNAKLRQENIELGEKLKKLI    211 - 280
EQYALREEHIDKVFKHKELQQQLVDAKLQQTTQLIKEADEKHQREREFLLKEATESRHKYEQMKQQEVQL    281 - 350
KQQLSLYMDKFEEFQTTMAKSNELFTTFRQEMEKMTKKIKKLEKETIIWRTKWENNNKALLQMAEEKTVR    351 - 420
DKEYKALQIKLERLEKLCRALQTERNELNEKVEVLKEQVSIKAAIKAANRDLATPVMQPCTALDSHKELN    421 - 490
TSSKRALGAHLEAEPKSQRSAVQKPPSTGSAPAIESVD                                    491 - 528
//

Text Mined References (22)

PMID Year Title