Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.1439603231421E-10
juvenile dermatomyositis 1189 2.91458929106611E-8
glioblastoma 5572 5.37793104194853E-8
osteosarcoma 7933 2.22068899128583E-6
ependymoma 2514 6.12762288577719E-6
atypical teratoid / rhabdoid tumor 4369 1.61830159992644E-5
primitive neuroectodermal tumor 3031 2.42723044162427E-5
Pick disease 1893 7.65250670176038E-5
hepatocellular carcinoma 550 1.3303175309081E-4
medulloblastoma, large-cell 6234 1.80562197421685E-4
tuberculosis and treatment for 6 months 686 8.08660113330403E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00299406018559015
adult high grade glioma 2148 0.00317420168794654
group 3 medulloblastoma 2254 0.00346950702286917
progressive supranuclear palsy 674 0.00556017100723865
astrocytic glioma 2241 0.00739332612672955
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00863194015922451
sarcoidosis 368 0.0148996595116532
gastric cancer 436 0.0195485828934105
oligodendroglioma 2849 0.036563213617295
Disease Target Count Z-score Confidence
Brain cancer 24 0.0 1.0

Expression

Synonym

Accession Q9NUP7 Q5VVL0 Q9NW65
Symbols CCDC76

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

AA Sequence

MATSATSPHAPGFPAEGRCGYYVEKKKRFCRMVVAAGKRFCGEHAGAAEEEDARKRILCPLDPKHTVYED      1 - 70
QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLEKLIKKLRKASEGLNSTLKDH     71 - 140
IMSHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAGKGKLSHWVDIALKDAEKV    141 - 210
HFILVEKVTTRFKVDGKHRKKNSVFERLQIDIQHLCLNKIPVLREEKLPVVGIGKHLCGMATDLALRCLV    211 - 280
ETYAASFEERNEEPLAKRIKNDKTEKEIYTLAKEGNEKNVPEKWNPVAGIVIALCCHHRCDWRHYVGKEY    281 - 350
FRALGLGAVEFHYFQRMSSWATCGMRKTSLETSNSTTKRQDNQNDDSEEHDDGGYRITDDGADCLPGLLS    351 - 420
VEEKKKIGHLCKLLIDQGRIQYLQQKGFSPALQYYTDPLVSLENVLLTALPNHSSSPETTA             421 - 481
//

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18703587 2008 A novel CHHC Zn-finger domain found in spliceosomal proteins and tRNA modifying enzymes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11799066 2002 Isolating human transcription factor targets by coupling chromatin immunoprecipitation and CpG island microarray analysis.