Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.300 3.2e-03
astrocytic glioma 2.000 7.4e-03
Astrocytoma, Pilocytic 1.100 9.9e-04
atypical teratoid / rhabdoid tumor 1.400 1.6e-05
ependymoma 1.100 6.1e-06
gastric cancer 1.100 2.0e-02
glioblastoma 1.500 5.4e-08
group 3 medulloblastoma 1.800 3.5e-03
hepatocellular carcinoma 1.100 1.3e-04
intraductal papillary-mucinous adenoma (... 1.300 3.0e-03
intraductal papillary-mucinous carcinoma... 1.200 8.6e-03
juvenile dermatomyositis 1.143 2.9e-08
medulloblastoma, large-cell 1.600 1.8e-04
oligodendroglioma 1.300 3.7e-02
osteosarcoma 2.230 2.2e-06
ovarian cancer -2.800 3.1e-10
Pick disease -1.700 2.6e-05
primitive neuroectodermal tumor 1.800 2.4e-05
progressive supranuclear palsy -2.100 5.6e-03
sarcoidosis 1.300 1.5e-02
tuberculosis and treatment for 6 months -1.100 8.1e-04

AA Sequence

MATSATSPHAPGFPAEGRCGYYVEKKKRFCRMVVAAGKRFCGEHAGAAEEEDARKRILCPLDPKHTVYED      1 - 70
QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLEKLIKKLRKASEGLNSTLKDH     71 - 140
IMSHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAGKGKLSHWVDIALKDAEKV    141 - 210
HFILVEKVTTRFKVDGKHRKKNSVFERLQIDIQHLCLNKIPVLREEKLPVVGIGKHLCGMATDLALRCLV    211 - 280
ETYAASFEERNEEPLAKRIKNDKTEKEIYTLAKEGNEKNVPEKWNPVAGIVIALCCHHRCDWRHYVGKEY    281 - 350
FRALGLGAVEFHYFQRMSSWATCGMRKTSLETSNSTTKRQDNQNDDSEEHDDGGYRITDDGADCLPGLLS    351 - 420
VEEKKKIGHLCKLLIDQGRIQYLQQKGFSPALQYYTDPLVSLENVLLTALPNHSSSPETTA             421 - 481
//

Text Mined References (10)

PMID Year Title