Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.11
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 9.94947193725441E-15
glioblastoma 5572 8.52088272605016E-11
atypical teratoid/rhabdoid tumor 1095 1.83360347390775E-10
sonic hedgehog group medulloblastoma 1482 3.04796088538072E-7
osteosarcoma 7933 3.10622599444038E-7
malignant mesothelioma 3163 1.71979484713063E-6
adult high grade glioma 2148 8.03937296208614E-6
oligodendroglioma 2849 0.00555246562030617

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
oligodendroglioma -1.100 0.006
osteosarcoma 1.831 0.000
posterior fossa group B ependymoma -1.700 0.000
glioblastoma -1.300 0.000
adult high grade glioma -1.100 0.000
atypical teratoid/rhabdoid tumor -1.200 0.000
sonic hedgehog group medulloblastoma -1.300 0.000

Synonym

Accession Q9NUE0 A6NHY9 B4DQ84 Q5JYH0 Q9H020
Symbols DHHC18
DHHC-18

Gene

  Ortholog (8)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

AA Sequence

MKDCEYQQISPGAAPLPASPGARRPGPAASPTPGPGPAPPAAPAPPRWSSSGSGSGSGSGSLGRRPRRKW      1 - 70
EVFPGRNRFYCGGRLMLAGHGGVFALTLLLILTTTGLFFVFDCPYLARKLTLAIPIIAAILFFFVMSCLL     71 - 140
QTSFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLKYCFTCKMFRPPRTSHCSV    141 - 210
CDNCVERFDHHCPWVGNCVGRRNYRFFYAFILSLSFLTAFIFACVVTHLTLRAQGSNFLSTLKETPASVL    211 - 280
ELVICFFSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPLPPS    281 - 350
LIDRRGFVQSDTVLPSPIRSDEPACRAKPDASMVGGHP                                    351 - 388
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.