Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.11
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
oligodendroglioma -1.100 0.006
osteosarcoma 1.831 0.000
posterior fossa group B ependymoma -1.700 0.000
glioblastoma -1.300 0.000
adult high grade glioma -1.100 0.000
atypical teratoid/rhabdoid tumor -1.200 0.000
sonic hedgehog group medulloblastoma -1.300 0.000

Synonym

Accession Q9NUE0 A6NHY9 B4DQ84 Q5JYH0 Q9H020
Symbols DHHC18
DHHC-18

Gene

AA Sequence

MKDCEYQQISPGAAPLPASPGARRPGPAASPTPGPGPAPPAAPAPPRWSSSGSGSGSGSGSLGRRPRRKW      1 - 70
EVFPGRNRFYCGGRLMLAGHGGVFALTLLLILTTTGLFFVFDCPYLARKLTLAIPIIAAILFFFVMSCLL     71 - 140
QTSFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLKYCFTCKMFRPPRTSHCSV    141 - 210
CDNCVERFDHHCPWVGNCVGRRNYRFFYAFILSLSFLTAFIFACVVTHLTLRAQGSNFLSTLKETPASVL    211 - 280
ELVICFFSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPLPPS    281 - 350
LIDRRGFVQSDTVLPSPIRSDEPACRAKPDASMVGGHP                                    351 - 388
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.