Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 8.0e-06
atypical teratoid/rhabdoid tumor -1.200 1.8e-10
ependymoma -1.500 5.1e-16
glioblastoma -1.300 8.5e-11
malignant mesothelioma 1.500 1.7e-06
oligodendroglioma -1.100 5.6e-03
osteosarcoma 1.831 3.1e-07
sonic hedgehog group medulloblastoma -1.300 3.0e-07

AA Sequence

MKDCEYQQISPGAAPLPASPGARRPGPAASPTPGPGPAPPAAPAPPRWSSSGSGSGSGSGSLGRRPRRKW      1 - 70
EVFPGRNRFYCGGRLMLAGHGGVFALTLLLILTTTGLFFVFDCPYLARKLTLAIPIIAAILFFFVMSCLL     71 - 140
QTSFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLKYCFTCKMFRPPRTSHCSV    141 - 210
CDNCVERFDHHCPWVGNCVGRRNYRFFYAFILSLSFLTAFIFACVVTHLTLRAQGSNFLSTLKETPASVL    211 - 280
ELVICFFSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPLPPS    281 - 350
LIDRRGFVQSDTVLPSPIRSDEPACRAKPDASMVGGHP                                    351 - 388
//

Text Mined References (8)

PMID Year Title