Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.44
PubTator Score 11.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Hyperphosphatasia with Mental Retardation 5 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.2e-07
osteosarcoma 7950 2.0e-06
hepatocellular carcinoma 547 2.2e-06
tuberculosis 2010 1.3e-03
medulloblastoma, large-cell 6241 1.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Intellectual disability 1016 4.409 2.2

Expression

  Differential Expression (5)

Disease log2 FC p
hepatocellular carcinoma 1.200 2.2e-06
medulloblastoma, large-cell -1.200 1.8e-03
osteosarcoma -2.592 2.0e-06
ovarian cancer -1.200 2.2e-07
tuberculosis -1.200 1.3e-03

Gene RIF (6)

AA Sequence

MWPQDPSRKEVLRFAVSCRILTLMLQALFNAIIPDHHAEAFSPPRLAPSGFVDQLVEGLLGGLSHWDAEH      1 - 70
FLFIAEHGYLYEHNFAFFPGFPLALLVGTELLRPLRGLLSLRSCLLISVASLNFLFFMLAAVALHDLGCL     71 - 140
VLHCPHQSFYAALLFCLSPANVFLAAGYSEALFALLTFSAMGQLERGRVWTSVLLFAFATGVRSNGLVSV    141 - 210
GFLMHSQCQGFFSSLTMLNPLRQLFKLMASLFLSVFTLGLPFALFQYYAYTQFCLPGSARPIPEPLVQLA    211 - 280
VDKGYRIAEGNEPPWCFWDVPLIYSYIQDVYWNVGFLKYYELKQVPNFLLAAPVAILVAWATWTYVTTHP    281 - 350
WLCLTLGLQRSKNNKTLEKPDLGFLSPQVFVYVVHAAVLLLFGGLCMHVQVLTRFLGSSTPIMYWFPAHL    351 - 420
LQDQEPLLRSLKTVPWKPLAEDSPPGQKVPRNPIMGLLYHWKTCSPVTRYILGYFLTYWLLGLLLHCNFL    421 - 490
PWT                                                                       491 - 493
//

Text Mined References (17)

PMID Year Title