Property Summary

NCBI Gene PubMed Count 19
PubMed Score 26.80
PubTator Score 5.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma 1.018 2.0e-02
atypical teratoid / rhabdoid tumor -1.200 2.6e-02
facioscapulohumeral dystrophy -1.900 4.3e-03
group 3 medulloblastoma -1.900 2.1e-05
medulloblastoma, large-cell -2.000 1.3e-06
osteosarcoma -2.161 1.3e-06
posterior fossa group B ependymoma 1.200 1.0e-07

Gene RIF (6)

AA Sequence

MAARTLGRGVGRLLGSLRGLSGQPARPPCGVSAPRRAASGPSGSAPAVAAAAAQPGSYPALSAQAAREPA      1 - 70
AFWGPLARDTLVWDTPYHTVWDCDFSTGKIGWFLGGQLNVSVNCLDQHVRKSPESVALIWERDEPGTEVR     71 - 140
ITYRELLETTCRLANTLKRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAVHTVIFAGFSAESLAGRIND    141 - 210
AKCKVVITFNQGLRGGRVVELKKIVDEAVKHCPTVQHVLVAHRTDNKVHMGDLDVPLEQEMAKEDPVCAP    211 - 280
ESMGSEDMLFMLYTSGSTGMPKGIVHTQAGYLLYAALTHKLVFDHQPGDIFGCVADIGWITGHSYVVYGP    281 - 350
LCNGATSVLFESTPVYPNAGRYWETVERLKINQFYGAPTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPI    351 - 420
NCEAWEWLHRVVGDSRCTLVDTWWQTETGGICIAPRPSEEGAEILPAMAMRPFFGIVPVLMDEKGSVVEG    421 - 490
SNVSGALCISQAWPGMARTIYGDHQRFVDAYFKAYPGYYFTGDGAYRTEGGYYQITGRMDDVINISGHRL    491 - 560
GTAEIEDAIADHPAVPESAVIGYPHDIKGEAAFAFIVVKDSAGDSDVVVQELKSMVATKIAKYAVPDEIL    561 - 630
VVKRLPKTRSGKVMRRLLRKIITSEAQELGDTTTLEDPSIIAEILSVYQKCKDKQAAAK               631 - 689
//

Text Mined References (23)

PMID Year Title