Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.00
PubTator Score 29.16

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

AA Sequence

MAAGEPRSLLFFQKPVTFEDVAVNFTQEEWDCLDASQRVLYQDVMSETFKNLTSVARIFLHKPELITKLE      1 - 70
QEEEQWRETRVLQASQAGPPFFCYTCGKCFSRRSYLYSHQFVHNPKLTNSCSQCGKLFRSPKSLSYHRRM     71 - 140
HLGERPFCCTLCDKTYCDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECT    141 - 210
LRIPGTQAEFQTPIARSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAPITGT    211 - 280
LCQDARSNSHPVKPSRLNVFCCPHCSLTFSKKSYLSRHQKAHLTEPPNYCFHCSKSFSSFSRLVRHQQTH    281 - 350
WKQKSYLCPICDLSFGEKEGLMDHWRGYKGKDLCQSSHHKCRVILGQWLGFSHDVPTMAGEEWKHGGDQS    351 - 420
PPRIHTPRRRGLREKACKGDKTKEAVSILKHK                                          421 - 452
//

Text Mined References (17)

PMID Year Title