Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.03
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
COPD 118 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
COPD -1.100 1.3e-02

Gene RIF (2)

AA Sequence

MAAENSKQFWKRSAKLPGSIQPVYGAQHPPLDPRLTKNFIKERSKVNTVPLKNKKASSFHEFARNTSDAW      1 - 70
DIGDDEEEDFSSPSFQTLNSKVALATAAQVLENHSKLRVKPERSQSTTSDVPANYKVIKSSSDAQLSRNS     71 - 140
SDTCLRNPLHKQQSLPLRPIIPLVARISDQNASGAPPMTVREKTRLEKFRQLLSSQNTDLDELRKCSWPG    141 - 210
VPREVRPITWRLLSGYLPANTERRKLTLQRKREEYFGFIEQYYDSRNEEHHQDTYRQIHIDIPRTNPLIP    211 - 280
LFQQPLVQEIFERILFIWAIRHPASGYVQGINDLVTPFFVVFLSEYVEEDVENFDVTNLSQDMLRSIEAD    281 - 350
SFWCMSKLLDGIQDNYTFAQPGIQKKVKALEELVSRIDEQVHNHFRRYEVEYLQFAFRWMNNLLMRELPL    351 - 420
RCTIRLWDTYQSEPEGFSHFHLYVCAAFLIKWRKEILDEEDFQGLLMLLQNLPTIHWGNEEIGLLLAEAY    421 - 490
RLKYMFADAPNHYRR                                                           491 - 505
//

Text Mined References (16)

PMID Year Title