Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.00
PubTator Score 144.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.303 1.5e-08
Astrocytoma, Pilocytic 1.200 9.0e-06
atypical teratoid / rhabdoid tumor 1.200 5.8e-05
ependymoma 1.300 3.7e-11
glioblastoma 1.400 4.6e-09
group 3 medulloblastoma 2.000 2.9e-05
malignant mesothelioma 1.500 5.1e-07
medulloblastoma, large-cell 1.600 3.3e-05
Multiple myeloma 1.382 3.9e-03
osteosarcoma -1.501 1.3e-04
ovarian cancer -1.100 1.1e-03
pediatric high grade glioma 1.400 3.4e-07
primitive neuroectodermal tumor 1.500 1.2e-04
psoriasis -1.300 6.9e-04
Waldenstrons macroglobulinemia 1.122 5.1e-03

Gene RIF (2)

AA Sequence

MAVVIRLQGLPIVAGTMDIRHFFSGLTIPDGGVHIVGGELGEAFIVFATDEDARLGMMRTGGTIKGSKVT      1 - 70
LLLSSKTEMQNMIELSRRRFETANLDIPPANASRSGPPPSSGMSSRVNLPTTVSNFNNPSPSVVTATTSV     71 - 140
HESNKNIQTFSTASVGTAPPNMGASFGSPTFSSTVPSTASPMNTVPPPPIPPIPAMPSLPPMPSIPPIPV    141 - 210
PPPVPTLPPVPPVPPIPPVPSVPPMTPLPPMSGMPPLNPPPVAPLPAGMNGSGAPMNLNNNLNPMFLGPL    211 - 280
NPVNPIQMNSQSSVKPLPINPDDLYVSVHGMPFSAMENDVRDFFHGLRVDAVHLLKDHVGRNNGNGLVKF    281 - 350
LSPQDTFEALKRNRMLMIQRYVEVSPATERQWVAAGGHITFKQNMGPSGQTHPPPQTLPRSKSPSGQKRS    351 - 420
RSRSPHEAGFCVYLKGLPFEAENKHVIDFFKKLDIVEDSIYIAYGPNGKATGEGFVEFRNEADYKAALCR    421 - 490
HKQYMGNRFIQVHPITKKGMLEKIDMIRKRLQNFSYDQREMILNPEGDVNSAKVCAHITNIPFSITKMDV    491 - 560
LQFLEGIPVDENAVHVLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMREIEKN    561 - 630
PPAQGKKGLKMPVPGNPAVPGMPNAGLPGVGLPSAGLPGAGLPSTGLPGSAITSAGLPGAGMPSAGIPSA    631 - 700
GGEEHAFLTVGSKEANNGPPFNFPGNFGGSNAFGPPIPPPGLGGGAFGDARPGMPSVGNSGLPGLGLDVP    701 - 770
GFGGGPNNLSGPSGFGGGPQNFGNGPGSLGGPPGFGSGPPGLGSAPGHLGGPPAFGPGPGPGPGPGPIHI    771 - 840
GGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEA    841 - 910
TAAVIDLNDRPIGSRKVKLVLG                                                    911 - 932
//

Text Mined References (27)

PMID Year Title