Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.33
PubTator Score 144.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 3.70126754644888E-11
glioblastoma 5572 4.62008921675363E-9
acute quadriplegic myopathy 1157 1.46956063028681E-8
pediatric high grade glioma 2712 3.35238421001627E-7
malignant mesothelioma 3163 5.09136790049922E-7
atypical teratoid/rhabdoid tumor 1095 2.56407859238298E-6
pilocytic astrocytoma 3086 7.3576312972445E-6
group 3 medulloblastoma 2254 2.86693973608257E-5
medulloblastoma, large-cell 6234 3.3094414737515E-5
primitive neuroectodermal tumor 3031 1.19062180442713E-4
osteosarcoma 7933 1.29640354064072E-4
ovarian cancer 8492 2.22289193160089E-4
psoriasis 6685 6.93561367196668E-4
Multiple myeloma 1328 0.00387126818589687
Waldenstrons macroglobulinemia 765 0.00506902645270846
Disease Target Count Z-score Confidence
Gas gangrene 15 3.829 1.9
Acute monocytic leukemia 11 3.559 1.8

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.122 0.005
Multiple myeloma 1.382 0.004
malignant mesothelioma 1.500 0.000
psoriasis -1.300 0.001
osteosarcoma -1.501 0.000
ependymoma 1.300 0.000
glioblastoma 1.400 0.000
group 3 medulloblastoma 2.000 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.600 0.000
primitive neuroectodermal tumor 1.500 0.000
acute quadriplegic myopathy 1.303 0.000
pediatric high grade glioma 1.400 0.000
pilocytic astrocytoma 1.200 0.000
ovarian cancer 2.100 0.000

Synonym

Accession Q9NTZ6 B3KRU2 E1P5R6 O94865 Q8N3B1 Q9H196
Symbols SWAN
HRIHFB2091

Gene

PDB

1WEL   2CPY   2DNN   2EK1   2EK6  

  Ortholog (7)

Species Source
Mouse OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
18831769 RBM12 shares a promoter and 5'UTR exons with CPNE1. This genomic structure is conserved among multiple species.

AA Sequence

MAVVIRLQGLPIVAGTMDIRHFFSGLTIPDGGVHIVGGELGEAFIVFATDEDARLGMMRTGGTIKGSKVT      1 - 70
LLLSSKTEMQNMIELSRRRFETANLDIPPANASRSGPPPSSGMSSRVNLPTTVSNFNNPSPSVVTATTSV     71 - 140
HESNKNIQTFSTASVGTAPPNMGASFGSPTFSSTVPSTASPMNTVPPPPIPPIPAMPSLPPMPSIPPIPV    141 - 210
PPPVPTLPPVPPVPPIPPVPSVPPMTPLPPMSGMPPLNPPPVAPLPAGMNGSGAPMNLNNNLNPMFLGPL    211 - 280
NPVNPIQMNSQSSVKPLPINPDDLYVSVHGMPFSAMENDVRDFFHGLRVDAVHLLKDHVGRNNGNGLVKF    281 - 350
LSPQDTFEALKRNRMLMIQRYVEVSPATERQWVAAGGHITFKQNMGPSGQTHPPPQTLPRSKSPSGQKRS    351 - 420
RSRSPHEAGFCVYLKGLPFEAENKHVIDFFKKLDIVEDSIYIAYGPNGKATGEGFVEFRNEADYKAALCR    421 - 490
HKQYMGNRFIQVHPITKKGMLEKIDMIRKRLQNFSYDQREMILNPEGDVNSAKVCAHITNIPFSITKMDV    491 - 560
LQFLEGIPVDENAVHVLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMREIEKN    561 - 630
PPAQGKKGLKMPVPGNPAVPGMPNAGLPGVGLPSAGLPGAGLPSTGLPGSAITSAGLPGAGMPSAGIPSA    631 - 700
GGEEHAFLTVGSKEANNGPPFNFPGNFGGSNAFGPPIPPPGLGGGAFGDARPGMPSVGNSGLPGLGLDVP    701 - 770
GFGGGPNNLSGPSGFGGGPQNFGNGPGSLGGPPGFGSGPPGLGSAPGHLGGPPAFGPGPGPGPGPGPIHI    771 - 840
GGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEA    841 - 910
TAAVIDLNDRPIGSRKVKLVLG                                                    911 - 932
//

Text Mined References (23)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
18831769 2008 Promoter-sharing by different genes in human genome--CPNE1 and RBM12 gene pair as an example.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...